KEGG   Agrobacterium radiobacter: Arad_1702Help
Entry
Arad_1702         CDS       T00850                                 

Gene name
ndk
Definition
(GenBank) nucleoside-diphosphate-kinase protein
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00230  Purine metabolism
ara00240  Pyrimidine metabolism
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01130  Biosynthesis of antibiotics
Module
ara_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ara_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ara_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Arad_1702 (ndk)
   00240 Pyrimidine metabolism
    Arad_1702 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ara04131]
    Arad_1702 (ndk)
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Arad_1702 (ndk)
Membrane trafficking [BR:ara04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Arad_1702 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ACM26071
UniProt: B9JCT4
Position
1:1351073..1351495
Genome map
AA seq 140 aa AA seqDB search
MAIERTFSMIKPDATKRNLTGAITKIFEDNGLRVIASKRVWMSKREAEGFYAVHKERPFF
GELVDGMTSGPTVVQVLEGEGAILKNREIMGATNPANAAEGTIRKIHALSIGENSVHGSD
APETAAVEIAYWFSETEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaacgcactttttcgatgatcaagccggacgcaaccaagcgtaacctgact
ggcgccatcaccaagatttttgaagacaatggcctgcgcgtcatcgcttccaagcgcgtc
tggatgagcaagcgcgaggccgaaggcttctacgccgttcacaaggaacgtcctttcttc
ggcgaactcgtcgacggcatgacctccggcccgaccgtcgttcaggtcctggaaggcgaa
ggcgccatcctgaagaaccgcgaaatcatgggtgctaccaacccggccaacgccgctgaa
ggcacgatccgcaagatccacgccctgtcgatcggcgaaaattccgttcatggctccgac
gcgccggaaactgctgccgtcgaaatcgcctactggttctccgaaaccgaaatcgtcggc
tga

DBGET integrated database retrieval system