KEGG   Agrobacterium radiobacter: Arad_1706Help
Entry
Arad_1706         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-CGNR ABATE DUF2256
Motif
Other DBs
NCBI-ProteinID: ACM26073
UniProt: B9JCT6
Position
1:complement(1352076..1352627)
Genome map
AA seq 183 aa AA seqDB search
MSFSWTPHRFSGGALALDVANSVILRHDDERRTDRFEAPGQMESFPKAAANFCAERALFD
DILPVRLENRPDFIALRETIDRYFRARVLDRGADALLADLLEALSKVLRQAASPDGLDAA
TVYSTLRLIAMPDPERMKICRNCGWLFIDRSKNKSRAWCDMAVCGNRAKASRHYRRKKEE
STP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttcctggactccacatcgtttttccggtggcgcgctggcgctggatgtcgcc
aacagcgtcattctgcgccatgacgacgagcggcgcaccgaccgcttcgaggcgccgggg
cagatggagagttttccaaaggcagccgcgaatttctgcgccgagcgagcgctgttcgat
gacatcctaccggtacggctggaaaacagacctgacttcatcgcactccgcgaaacaata
gaccgctatttccgcgcccgtgtccttgatcgcggtgccgatgcgctactggccgatttg
ctggaagcgctatcgaaagtgctgaggcaagctgcctctcccgatgggctcgatgccgcg
acggtctattccaccttgcggctgatcgcgatgccagaccccgagcgcatgaagatctgc
cgcaactgcggctggctgttcatcgaccgcagcaaaaacaagagccgggcctggtgcgac
atggcggtctgcggcaaccgcgccaaggcgagccggcattatcgccgcaaaaaggaggag
agcacgccatga

DBGET integrated database retrieval system