KEGG   Agrobacterium radiobacter: Arad_1707Help
Entry
Arad_1707         CDS       T00850                                 

Definition
(GenBank) branched-chain amino acid ABC transporter
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
ara  Agrobacterium radiobacter
Pathway
ara02010  ABC transporters
ara02024  Quorum sensing
Module
ara_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:ara00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Arad_1707
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Arad_1707
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ara02000]
    Arad_1707
Transporters [BR:ara02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Arad_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ACM26074
UniProt: B9JCT7
Position
1:1352692..1353588
Genome map
AA seq 298 aa AA seqDB search
MAYLLQQLANAVPLAALYAALAFGYAIAFGVMKRADITYGALFAFAGQMLVLFTDVGYTR
LILILPAALAFGAAIAAFYTLGTSLLVGRAIMLPLSRKSPNTVIVAALGMMIILMETARL
ASNTRGIWLPPFLNDMIVFWDSGDFRVTLTKIQLINTALMVLMILGGAYVLRYTGWGRIW
RAVTDDALAAELCGTSANRVFLLAYVASALVATVCGLLATSYYGTMDFGAGLMFGLKVLL
IAAVGGYSDPLKSAGGAALLGLFETLWGAYGPFLWRDFVIFSLLVLLLVLSRRERVAP
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcctatctcctgcagcaactggcgaatgccgttccgctcgccgcgctctatgcggcg
ctggccttcggctatgccattgcttttggggtgatgaagcgggccgatatcacctatggg
gcgctctttgcctttgccggccagatgctggtcctgttcactgacgtcggctatacgagg
ctcatcctgatcctgccggcggctcttgctttcggtgctgccatcgcggctttctatacc
ttgggaacaagccttctcgtcggccgcgcgatcatgctgccgctgtcgcgcaagtcgccg
aacacggtgatcgttgcggctctcggcatgatgatcatcctgatggagacggcgcggctt
gcctccaatacgcgcggcatctggctgccgcctttcctgaacgatatgatcgtgttctgg
gacagcggcgatttccgcgtcacgctcaccaagatccagctcatcaacacggcgctgatg
gtcctgatgatcctcggtggagcctatgtgcttagatataccggatggggccgtatctgg
cgggcggtgacggatgatgcgctggccgccgagctttgcggcacaagcgccaatcgcgtc
tttcttctggcctatgtcgcctccgccctggtcgcgaccgtctgcggcctgctcgcgacg
tcctattacggcacgatggatttcggcgctgggctgatgttcgggctgaaggtgctgctg
atcgccgctgtcggcggctattccgatccgctgaaatcggcgggtggggcggcactgctt
ggcctgttcgagaccttgtggggcgcctatggcccgttcctgtggcgtgatttcgtgatc
ttctcgctgctggtcctgctgctggtgctgagccggcgcgagcgcgtggctccctga

DBGET integrated database retrieval system