KEGG   Agrobacterium radiobacter: Arad_1720Help
Entry
Arad_1720         CDS       T00850                                 

Definition
(GenBank) DNA methylase protein
  KO
K07115  23S rRNA (adenine2030-N6)-methyltransferase [EC:2.1.1.266]
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ara03009]
    Arad_1720
Enzymes [BR:ara01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.266  23S rRNA (adenine2030-N6)-methyltransferase
     Arad_1720
Ribosome biogenesis [BR:ara03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Arad_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsmJ Cons_hypoth95 DUF1148 DUF2020
Motif
Other DBs
NCBI-ProteinID: ACM26082
UniProt: B9JCU5
Position
1:complement(1359780..1360631)
Genome map
AA seq 283 aa AA seqDB search
MNYRHIYHAGNFADVLKHAVLARLVRYMQNKDKAFRVLDTHAGIGLYDLSSEEAQKTGEW
QDGIGRLLDAELVPQLAELLEPYLTAVRELNPDGGLQFYPGSPKLARMLFRSQDRLSAME
LHPEDFQRLHRLFEGDHHARITELDGWLALGAHLPPKEKRGIVLVDPPFEEEDEYERLAD
GLAKAWRRFPGGTYCLWYPIKKDAPIKAFHETLQALEIPKVLCAELTVKSDRGFTGLTGS
GLIIVNPPFTLKDELHALLPALKDMLAQDRFASQRAFWLRGEH
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcggcatatctaccacgcaggcaatttcgccgatgtgctcaagcacgcagtg
cttgcccggctcgtccgctacatgcagaacaaggacaaggcgttccgcgttctggatacc
catgccggcatcgggctctacgacctctcttcggaggaggcgcagaagaccggcgaatgg
caggatggtatcggccggcttctcgatgccgagctcgtgccgcagctcgccgagctgctg
gaaccctatctgaccgccgttcgcgaactcaaccccgatggcggcctgcaattctatccc
ggttctccgaagctcgcccgcatgctgttccgctcgcaggaccggctatcggcgatggag
ctgcaccccgaggacttccagcggctgcaccggctgttcgagggcgaccaccatgcgcgc
atcaccgagctcgatggctggctggcgctcggcgcacatctgccgccgaaggagaagcgc
ggcattgtgctggtcgacccgcccttcgaggaagaggacgaatatgagcggctggcggat
ggccttgccaaagcctggcgccgttttcccggcggcacctattgcctctggtatccgatc
aagaaggatgcgccgatcaaggccttccacgagacgctgcaggcattggagatccccaag
gtcctctgcgccgaactgacggtcaagagcgaccggggcttcaccgggctgacaggctcc
ggtctcatcatcgtcaatccgcccttcacgctgaaggacgagctgcacgcgctgctgccg
gcgctgaaagatatgctggcgcaggatcgttttgcctcgcaacgggccttctggctgcgc
ggcgaacactga

DBGET integrated database retrieval system