KEGG   Agrobacterium radiobacter: Arad_1724Help
Entry
Arad_1724         CDS       T00850                                 

Gene name
purN
Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00230  Purine metabolism
ara00670  One carbon pool by folate
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01130  Biosynthesis of antibiotics
Module
ara_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Arad_1724 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Arad_1724 (purN)
Enzymes [BR:ara01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Arad_1724 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ACM26086
UniProt: B9JCU9
Position
1:complement(1364759..1365436)
Genome map
AA seq 225 aa AA seqDB search
MSSARKRVVVFISGSGSNMMALVKAAAASDYPAEIVAVISDKADAGGLAKAAAEGIATYA
FVRKDFASKDAHEEAILAQLSALSPDIICLAGYMRLLTGRFIQSYEGRIINIHPSLLPLF
PGLHTHQRAIDAGQRIAGCTVHFVTEGMDEGPVIGQAAVPVLTDDTADALAARVLTIEHQ
LYPQSLRLLAEGKVRMESGKAVTTAKAPAAAGQQILSLLGDVSRI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggcccgcaaacgcgtcgtcgtcttcatttcgggcagcggctccaacatgatg
gcgctggtcaaggcggctgcggcttcagactatccggccgaaatcgtcgccgtcatttcc
gacaaggcggatgcgggcgggctggcgaaggccgccgccgagggcattgccacctacgcc
ttcgtgcgcaaggatttcgccagcaaggacgcgcatgaggaggccatcctcgcgcagctc
tcggcgctttcgcccgacatcatctgccttgccggctatatgcgcctgctcaccggccgc
ttcatccagagctacgaaggccggattatcaacattcatccgtcgctgctgccgcttttc
cctggcctgcacacgcatcagcgtgccatcgacgcaggccagcggatcgccggctgcacc
gtgcatttcgtcaccgaaggcatggacgaaggtccggtgatcggccaagcggccgtgccg
gtgctgaccgatgataccgccgacgcgctggctgcgcgcgtgctgacgatcgagcatcag
ctctatcctcagtcgctgcggctgctggcggaaggcaaggtccggatggaaagcggcaag
gccgttaccacggcaaaggcaccggctgccgctggccagcagattctgtccctgcttggc
gacgtcagccggatctag

DBGET integrated database retrieval system