KEGG   Agrobacterium radiobacter: Arad_1725Help
Entry
Arad_1725         CDS       T00850                                 

Gene name
purM
Definition
(GenBank) 5'-phosphoribosyl-5-aminoimidazole synthetase protein
  KO
K01933  phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00230  Purine metabolism
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01130  Biosynthesis of antibiotics
Module
ara_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Arad_1725 (purM)
Enzymes [BR:ara01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     Arad_1725 (purM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ACM26087
UniProt: B9JCV0
Position
1:complement(1365433..1366506)
Genome map
AA seq 357 aa AA seqDB search
MSQSGKNGLTYSDAGVDIDAGNLLVEKIKPAVRSTRRPGADGEIGGFGGLFDLKAAGFTD
PVLVAANDGVGTKLKIAIDADYHDTVGIDLVAMCVNDLVVQGAEPLFFLDYFATGKLDPD
QGAAIVGGIAAGCREAGCALIGGETAEMPGMYSDGDYDLAGFAVGAAERGQLLPSGDIAE
GDVILGLASSGVHSNGFSLVRKIVDLSGLAWDAPAPFAEGKALGEALLTPTRIYVKPLLK
AIRETHAIKALAHITGGGFPENIPRVLPKHLAAEIDLTAVKVPPVFSWLAKTGGVEAKEM
LRTFNCGIGMIAVVAAENVDTVKAALEAEGESIVTLGRMIARDEGAAGTVYKGTLDL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtctggaaaaaacggtctgacctatagcgacgcgggcgtcgatatcgatgcc
ggcaacctgctggtcgaaaagatcaaacccgccgtgcgttcgacgcgccgtcctggcgcc
gatggcgaaatcggcggcttcggcggcctcttcgacctgaaggccgcaggcttcaccgat
ccggtgctggttgccgccaatgacggcgtcggcaccaagctgaagatcgccatcgacgcc
gactatcacgacaccgtcggcatcgacctcgtcgccatgtgcgtcaacgacctcgtcgtc
cagggcgcagagccactgttcttcctcgattatttcgccaccggcaagctcgaccccgat
cagggtgcggcgatcgtcggcggcattgctgccggctgccgcgaggcgggctgcgcattg
atcggcggcgagacggcggaaatgccgggcatgtattccgacggcgactatgaccttgcc
ggttttgccgtgggtgcggccgaacgcggccagcttcttccctccggcgatatcgcagag
ggtgacgtcattctcggcctcgcctcctccggcgttcattccaacggcttctcgctggtg
cgcaagatcgtcgatctctccggcctcgcctgggatgcgcctgctcccttcgcagaaggc
aaggcgctcggtgaagccctgctgacgccgacgcgcatctatgtgaagccgcttctgaag
gcgatccgtgagacccatgccatcaaggcgctcgcccacatcaccggcggcggctttccg
gaaaacattccgcgcgtattgccgaagcacctcgccgcggagattgatctcaccgccgtc
aaggtgccgccggtattctcgtggctcgccaagaccggcggtgtcgaggccaaggaaatg
ctgcgcaccttcaattgcggcatcggcatgatcgccgtcgtcgccgccgagaatgtcgat
accgtcaaggcggcgctcgaggccgaaggcgaatccatcgtcacgctcggccgcatgatc
gcccgcgacgaaggcgctgccggcaccgtctacaagggtacgctagatctatga

DBGET integrated database retrieval system