KEGG   Agrobacterium radiobacter: Arad_1726Help
Entry
Arad_1726         CDS       T00850                                 

Definition
(GenBank) permease protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport SNARE_assoc EI24
Motif
Other DBs
NCBI-ProteinID: ACM26088
UniProt: B9JCV1
Position
1:1366730..1367860
Genome map
AA seq 376 aa AA seqDB search
MKQQVSGTSLKRQVTFWVVVLAIFIVFLYLFSSILLPFIAGMAVAYFLDPVADRLERIGL
SRLMATVVILVAFVLFFALALTIVIPIIINQFNDFVQHIPGYVQQLQQLIAKTQTMVLPD
WVRNQLGVIKDNFSNIMSEGLSFVGGLFAQIWSSGKALVNIISLMVVTPVVAFYMLLDWD
RMIAKVDAWVPRDQVATVRQIATEIDQSIAGFIRGQGSLCIILGVYYGVGLSLVGLNFGL
LIGFFAGMISFIPYVGSLVGLFIAVSVALVQFWPDYIWVGLTLAVFFTGQFLEGNVLQPK
LVGESVGLHPVWLMFALFAFGALFGFVGLLVAVPAAAACGVLVRFALSRYLQSDLYYGHS
EADKARRAKAGNPEKN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacaagtcagcgggacgagcctcaagcgtcaggtcaccttctgggtggtcgtg
ctcgccatctttatcgtctttctctacctcttcagctcgatcctcttgcccttcatcgcc
ggcatggcagttgcttatttcctcgatccggttgccgaccggctggaaaggatcggcctc
agtcggctgatggcgacggtggtgatcctcgttgccttcgtgctgttcttcgcgctggcg
ctgacgatcgtcattccgatcatcatcaatcagttcaatgatttcgtccagcacataccg
ggctatgtgcagcagctgcagcagctcatcgccaagacgcagacgatggtgctgccggac
tgggtccgcaaccagctcggcgtcatcaaggacaatttctccaatatcatgtcggaaggg
ctgagcttcgtcggcggtttgttcgcgcagatctggagttccggcaaggcgctggtcaac
atcatctcgctgatggtcgtcactcccgtggtcgctttctatatgctgctcgactgggat
cgcatgattgccaaggtcgatgcctgggtgccgcgcgaccaggtcgccaccgtccgccag
attgccaccgagatcgatcagtcgatcgccggcttcatccgtggccaaggctcgctctgc
atcatcctcggcgtctattatggcgtcggcctgtcgctggtcggcctgaatttcggtctg
ttgatcgggttcttcgccggcatgatcagcttcatcccctatgtcggctcactggttggc
ctgttcatcgcggtcagtgtcgcgctggtgcagttctggccggattatatctgggtcggc
ctcacgctcgccgtcttcttcaccggccagttcctggaaggcaatgtgcttcagccgaag
ctggtcggcgaaagcgtcggcctgcatccggtctggctgatgttcgcgcttttcgccttc
ggcgcgctcttcggtttcgtcggcctgctggtcgccgttccggccgcggccgcctgtggt
gtgcttgttcgcttcgccctttcgcggtaccttcagagcgacctttattatggacactcg
gaagccgacaaggcgcgcagagccaaggccggcaatcctgagaaaaactag

DBGET integrated database retrieval system