KEGG   Agrobacterium radiobacter: Arad_1728Help
Entry
Arad_1728         CDS       T00850                                 

Gene name
ppk
Definition
(GenBank) polyphosphate kinase protein
  KO
K00937  polyphosphate kinase [EC:2.7.4.1]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00190  Oxidative phosphorylation
ara03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Arad_1728 (ppk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Arad_1728 (ppk)
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.1  polyphosphate kinase
     Arad_1728 (ppk)
Messenger RNA biogenesis [BR:ara03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     Arad_1728 (ppk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP_kinase_C PP_kinase PP_kinase_N PLDc_2
Motif
Other DBs
NCBI-ProteinID: ACM26090
UniProt: B9JCV3
Position
1:1368652..1370853
Genome map
AA seq 733 aa AA seqDB search
MDSAVTEQQDANQQATEAVPPINELLSSPERFINREFSWLQFNRRVLEETLNTAHPLLER
IRFLSISAANLDEFFMVRVAGLEGQVRQKILVRTPDGKTPAEQLDDILREIDNLQMEQQA
SLAVLQQYLAKEDILIVRPPALSEADRVWLANEFEQAIFPVLTPLSIDPAHPFPFIPNLG
FSIALQLNSMNGREPMTALLRLPPALDRFVRLPDASNVIRYITLEDVVNIFIQRLYPGYE
VQGSGTFRLIRDSDIEVEEEAEDLVRFFETALKRRRRGSVIRIETDSEMPLELRQFVVES
LNVPENRIAVLPGLLALNTLSEICKAPRDDLRFEPYNARFPERVREHAGDCFAAIREKDM
VVHHPYESFDVVVQFLIQAARDPDVLAIKQTLYRTSNDSPIVRALIDAADLGKSVTALVE
LKARFDEEANIRWARDLERAGVQVVFGFIELKTHSKMSMVVRREDGKLRTYCHLGTGNYH
PITAKIYTDLSYFTCDPKIAHDMANIFNFITGYGEPEPSTKIAVSPYTLRPRILQHIEEE
IEHAKSGKPAAIWMKMNSLVDPDIIDALYRASNAGVEIDLVIRGICCLRPQVQGLSENIR
VKSIIGRFLEHSRIFCFGNGHGLPSDKALVYIGSADMMPRNLDRRVETLVPLTNKTVHEQ
VLSQIMLGNIIDNQQSYEILPDGTSRRTEVRAGKEPFNAQQYFMTNPSLSGRGESLKSSA
PKLIAGLLSGRKK
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggactcggcagtaacggaacagcaggacgccaaccagcaggccacggaggccgtgccg
ccgatcaacgagctgctgagcagccccgaacgcttcatcaatcgtgaattttcctggctg
cagttcaatcgccgcgtcctcgaggaaacgctgaacacggcgcatccgcttctggagcgc
atccgcttcctctccatttctgccgccaacctcgatgaattcttcatggtgcgcgtcgca
ggcctcgagggccaggttcgccaaaagatcctggtgcgtacgccggatggcaagacgccc
gccgaacagctcgacgatatcctgcgcgagatcgacaacctgcagatggagcagcaggca
tcgcttgccgtgctgcaacaatatctcgccaaggaagacattctgatcgtccgcccgccg
gctctgtccgaggccgaccgggtctggctcgccaatgaattcgaacaggcgatcttcccg
gtcctgacgccgctctccatcgacccggcgcatccgttcccgttcattccgaacctcggc
ttttcgattgcgctgcagctgaacagcatgaacggccgcgagccgatgacggcgctgctg
cgcctgccgccggcgctcgaccgtttcgtccgcctgccggacgccagcaacgtcatccgc
tacatcacgctcgaagatgtcgtgaacatcttcattcagcggctctatcccggctatgag
gtacagggttcgggtacgttccgcctcatccgcgacagcgatatcgaagtcgaggaagaa
gccgaagatctggtgcgtttcttcgagacggcgctgaagcgccgccgccgtggttcggtg
atccgcatcgagaccgactcggagatgccgctcgaactgcgccagttcgtggtggaatcg
ctgaacgtaccggaaaaccgcatcgccgttctgccaggcctgctggcgctcaacaccctg
tccgagatatgcaaggctccgcgcgacgatctgcgcttcgagccctacaatgcgcgattt
cctgagcgcgtccgcgaacatgccggcgactgcttcgccgccatccgcgaaaaggacatg
gtggtccaccatccttacgaatcctttgacgtggtggtccagttcctgattcaggctgcg
cgcgatcctgatgttctggcgataaagcagacgctataccgcacctccaatgacagcccg
atcgtgcgtgcgctgatcgatgccgccgatctcggcaagtccgtgaccgcgctggtcgag
ctcaaggctcgtttcgacgaagaggcgaatatccgctgggcgcgagatctggaacgtgcc
ggtgtgcaggtcgtcttcggctttatcgaactcaagacgcattcgaagatgtcgatggtc
gtacgccgcgaggacggcaagctgcgcacctattgccatctcggtaccggcaactaccac
ccgatcactgccaagatctatacggacctgtcctacttcacctgcgacccgaagatcgcc
cacgacatggcgaacatcttcaactttatcaccggctatggcgagccggagccgagcacg
aagattgccgtttcgccctatacgctgcgcccgcgcatcctccagcacatcgaggaggaa
atcgagcacgccaagagcggcaagccggcggcgatctggatgaagatgaattcgctggtt
gatcccgacatcatcgatgcgctttatcgcgccagcaatgccggcgtcgagattgatctc
gtcatacgcggcatctgctgcttgcgtcctcaggtgcaaggtctgtccgaaaatatccgc
gtcaagtcgatcatcggccgcttccttgagcacagccgcatcttctgtttcggcaatggc
catggcctgccgtcggacaaggcgctggtctatatcggctcggccgacatgatgccgaga
aacctcgaccgacgtgtcgaaaccctcgtgccgctgaccaacaagaccgtgcacgagcag
gttctttcgcagatcatgctgggcaacatcattgacaatcagcagagctacgagatattg
ccggacggtacttcgaggcgcacggaggtgcgtgcggggaaagagccgttcaacgcgcag
cagtatttcatgaccaatcccagcctgtccggccgtggtgaatcgctgaaatccagtgcg
ccgaaactgatcgccgggctattgtcgggccgcaagaaataa

DBGET integrated database retrieval system