KEGG   Agrobacterium radiobacter: Arad_1729Help
Entry
Arad_1729         CDS       T00850                                 

Gene name
ppx2
Definition
(GenBank) exopolyphosphatase protein
  KO
K01524  exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Arad_1729 (ppx2)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     Arad_1729 (ppx2)
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     Arad_1729 (ppx2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ppx-GppA
Motif
Other DBs
NCBI-ProteinID: ACM26091
UniProt: B9JCV4
Position
1:1370864..1372384
Genome map
AA seq 506 aa AA seqDB search
MVESEAQGRLPGIAPVSVVDIGSNSVRLVVYEGHSRSPTILFNEKVLCGLGKGIALTGKM
DEESVARALAALHRFKALSDQARASTIYVLATAAAREASNGPEFIHKAETILQRKVRVLS
GEEEARFSALGIVSGFFHPNGIAGDLGGGSLELIDIKDREIGKGITLPLGGLRLSEYANG
SIEKARSFARKHVKTAKLLGQGEGRTFYAVGGTWRNIAKLHMEIRKYPLHMMQGYEVPLD
EMMRFLDQIGEAKETRDPAFLSISKHRRSLLPFGAVAMREVLAAMKPSVVTFSAQGVREG
YLYSLLTEAERNSDPLLTAAGELAILRARSPEHARELAEWTGRMMPFFGITETEEESRYR
QAACLLADISWRAHPDYRGLQALNIIAHTSFVGITHAGRAFIALANYYRFEGLHDDGATE
PLATIATPQLIERAKLLGGLLRVVYLFSASMPGIVRNLSIRRSSSPDLDLEFVVPAEYHD
FAGERLDGRLQQLAKLTNRRLAFRFE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggttgaatcagaagcccaggggcgccttcccggtatagccccggtctccgttgtcgat
atcgggtcgaactccgttcgtcttgtcgtctatgaaggccattcgcggtcgccgaccatt
cttttcaacgagaaggtgctgtgtggcctcggcaagggcatagccttgaccggaaagatg
gatgaggagagcgtagcacgcgctctcgccgccctgcaccggttcaaggcgctgtccgac
caggcgcgcgcatcgaccatctatgtcctggcgacggccgctgctcgcgaggcgagcaac
ggtccggaattcatccacaaggccgagacgatcctgcagcggaaagtacgcgtgctgtcg
ggcgaggaagaggcgcgtttttcggcgctcggcatcgtcagcggctttttccatccgaac
ggtatcgccggcgatctcggcggcggttcgctggagttgatcgacatcaaggaccgggag
atcggcaagggcattaccttgccgctcggcggcctgagattgtcggaatatgccaatggc
tcgatcgagaaagcccgcagctttgcccgcaagcatgtgaagaccgcaaagctgctcggc
cagggcgaggggcgtactttctacgcggtcggcggcacctggcgaaatatcgctaagctg
cacatggaaatccgcaaatatccgctgcacatgatgcagggttatgaagtgcctctcgac
gagatgatgcgcttcctcgatcagatcggcgaagccaaggaaactagggatccggcattc
ctatcgatttccaagcaccgtcgctcgctgctgcccttcggtgcggtggcgatgcgggaa
gtgctggcggccatgaagccatccgtcgtgacattctcggcccagggcgtgcgcgaaggc
tatctttattcgttgctgaccgaagccgagcgcaacagcgatccgctgctgacggccgcc
ggcgaacttgccattctgcgtgcccgctcgccggagcatgcccgcgagcttgccgaatgg
accggccggatgatgcccttcttcggcatcaccgagacggaggaggagagccgctatcgc
caggccgcgtgcctgcttgccgatatcagctggcgtgcccatcccgattatcgcggcctg
caggcgctgaacatcatcgctcacacgtccttcgtcggcatcacccatgccggccgcgcc
ttcatcgcgcttgccaattactatcgtttcgaaggcctgcacgacgacggcgcgaccgag
cccctggcaaccatcgccacgcctcagctcatcgagcgtgccaagctgctcggcggcctt
ttgcgcgtcgtctatctgttttcggcctcgatgccgggcatcgtgcgcaatctgtcgatc
cgtcgctcgtcgagcccggatctggacctcgaattcgtcgtcccggccgaatatcacgat
ttcgccggcgagcgactggatgggcgcttgcagcagctcgcaaagctgacgaaccggcgg
ttggcgttccggttcgaatag

DBGET integrated database retrieval system