KEGG   Agrobacterium radiobacter: Arad_1732Help
Entry
Arad_1732         CDS       T00850                                 

Gene name
rnd
Definition
(GenBank) ribonuclease D
  KO
K03684  ribonuclease D [EC:3.1.13.5]
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ara03016]
    Arad_1732 (rnd)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.5  ribonuclease D
     Arad_1732 (rnd)
Transfer RNA biogenesis [BR:ara03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    Arad_1732 (rnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A_exo1 HRDC E_Pc_C
Motif
Other DBs
NCBI-ProteinID: ACM26094
UniProt: B9JCV7
Position
1:complement(1375121..1376266)
Genome map
AA seq 381 aa AA seqDB search
MIETTAQLEAACQELAKSEFITIDTEFLRETTFWPELCLIQMASPTTEVLVDPLAKGLDL
KPFFELMANTAVMKVFHAARQDIEIIFNRGNLIPHPIFDTQVAAMVCGFGDSVSYDQLVS
RIKNIQIDKSSRFTDWSRRPLSEKQLDYALADVTHLRDVYLSLKEQLEREGRASWLLEEM
AILEARETYDLHPDDAWQRLKMRLRKPQELAVLKYVAAWREREARARNVPRARVLKDDAI
YEIAQQQPKDTEALARLRTIPKGWERSASGAAVLEAINQALALPKADMPHAPRHQQAPEG
TAAAAELLKVLLKLTAEKHGVAPKVIANSEDLDKIAAEGEKAEVAALTGWRRDLFGETAL
QLIQGQVALRFVGKRVETVAL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaactaccgcccagttagaggcggcctgccaagagctggccaagtcagaattc
attaccatcgacaccgaattcctgcgcgagacgacattctggccggagctttgcctgatt
cagatggcaagcccgacgactgaagtgctggttgatccgctagccaagggcctcgacttg
aaacccttcttcgagctgatggccaataccgctgtcatgaaggtgtttcatgctgcccgc
caggacatcgaaatcatcttcaatcgcggcaatctcattccgcatccaatcttcgacacg
caggtggccgccatggtctgcggcttcggcgattcggtttcctacgaccagctggtcagc
cgcatcaagaatatccagatcgacaagtcctcgcgcttcaccgactggagccgccggcca
ttgtcggaaaagcagctcgactatgcactggccgacgtcacccatcttcgcgatgtctat
ctttcgctgaaggagcagcttgagcgcgaaggccgtgcctcctggctgcttgaagaaatg
gcgatcctcgaagcgcgcgaaacctacgacctgcatcccgatgatgcctggcaaaggctg
aagatgcggctgcgcaagccgcaggaactggccgtgctgaaatatgtcgccgcctggcgc
gaacgcgaggcacgcgcccgcaacgtgccgcgtgcacgcgtgctgaaggatgacgccatc
tacgaaatcgcccagcagcagccgaaggacacggaagcgctcgcccgcctgcgcaccatc
cccaagggctgggagcgttccgcctcgggtgccgccgtgctcgaagcgatcaaccaggcc
cttgcactaccgaaagccgacatgccgcatgcaccgcgtcaccagcaggccccggagggc
actgccgccgctgccgaactgctgaaggttctgctgaagctcaccgccgaaaagcatggt
gtcgccccaaaggtcatcgccaacagtgaagacctcgacaagattgccgccgaaggcgag
aaggccgaggtagccgccctcaccggctggcggcgcgatctcttcggcgagacggcgctg
cagctcatccaaggccaagtcgcattgcgcttcgtcggcaaacgggtcgagacggtcgcc
ctctag

DBGET integrated database retrieval system