KEGG   Agrobacterium radiobacter: Arad_1736Help
Entry
Arad_1736         CDS       T00850                                 

Definition
(GenBank) Beta-lactamase class C protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ACM26097
UniProt: B9JCW0
Position
1:complement(1380602..1381771)
Genome map
AA seq 389 aa AA seqDB search
MSLPLENASRPSLGSFAQGVDAAIDAALIDKRLVGAVVLISRNGEQIYRRAAGLADRENG
VTMREETIFRLASVTKPIVAIAAMRLVEQGRIGLDDPITKWLPDFRPRLPDGNEAVIRIR
HLLTHTSGLGYTFAEEEGGPYHRAGVSDGLGEPGLSLAENLRRLASAPLRFAPGEGWQYS
LAMDVLGGILEKETGGRLDKAIAELVTGPLSLVDTAFSVRDSSRLAAAYMNGSPEPQRMG
DEAVAPILDGFIRFAPDRIFNPASYHSGGAGMAGTADDVLAILETVRKGGAPLLSGETVK
TMMADQAGGHMQPLMPGVGFGYGWSVVTDPTAANIPFSVGTVKWGGVYGHHWFVDPQKGL
TMVALTNTALEGMWGQFTVDLDNAVYAGL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttccccttgaaaacgcctctcggccgtccctcggctcttttgcccagggcgtc
gatgccgcaatcgatgctgccttgatagataagagactggtcggggccgtggttctgatc
tcacggaatggcgagcagatctatcgccgcgccgccggcctggcggatcgcgagaacggc
gtgaccatgcgggaggaaaccatcttccgcctcgcctccgtcaccaagccgatcgttgcc
atcgccgccatgcggcttgtcgaacagggccggataggtctggacgatccgataacgaaa
tggctgccggacttccggccacgcctgccggatgggaacgaagcggtcattcgtattcgg
cacctgctgacgcatacgtccggactgggttacacattcgccgaggaagaaggcggcccc
tatcaccgcgccggcgtgtccgatgggcttggtgaaccaggcctctcgcttgccgaaaat
ctgaggcgtctcgcaagcgcaccactgcgctttgcccctggagaaggctggcaatattca
ctggcgatggatgttctcggcggcatccttgaaaaggaaactggcggccgcctcgacaag
gcaattgcagagctggtgaccgggccgcttagtcttgtcgacaccgccttttcggtgcgc
gactcgagccgcctcgctgccgcctatatgaatggttcgcccgaaccacagcggatggga
gacgaggccgtggcgcccatactcgacggcttcattcggttcgcgccggaccggatattc
aacccggcctcctaccactccggtggcgccggcatggccggaacagcggatgatgtgctt
gccatcctggagaccgtgcgcaagggcggcgcgccgctcttgtccggcgagacggtcaaa
accatgatggcggatcaggcgggtgggcatatgcagccgctaatgccgggcgtcggcttt
ggttacggctggtccgtcgtcactgaccctaccgctgcgaatattccgttctccgtcgga
actgtgaagtggggcggcgtctatggccatcactggttcgtcgatccgcagaaaggcctc
accatggtggcactcaccaacactgcactcgaaggcatgtggggacaattcaccgtcgac
ctcgataatgcggtctacgcagggctctaa

DBGET integrated database retrieval system