KEGG   Agrobacterium radiobacter: Arad_1741Help
Entry
Arad_1741         CDS       T00850                                 

Definition
(GenBank) Phage maintenance killer protein
  KO
K07341  death on curing protein
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:ara02048]
    Arad_1741
Prokaryotic defense system [BR:ara02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Doc-Phd
    Arad_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fic
Motif
Other DBs
NCBI-ProteinID: ACM26101
UniProt: B9JCW4
Position
1:complement(1386342..1386734)
Genome map
AA seq 130 aa AA seqDB search
MSGYKWLTREAIEIMHHEQLAEHGGLVGLKDENALEAAVARPLNKAAYGENDLFALAAAY
LHGLVRNHPFSDGNKRTGYLAAFTFLYINGYLIDTDDGMIVAFVLGVAAGEIDETGATHF
LRDFSIPLSD
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatacaaatggctgacgcgcgaagccattgagatcatgcatcacgaacagctc
gcggagcatggcggattagtgggtctcaaagatgaaaacgcgctggaagctgctgtcgca
cgtccactaaacaaagctgcgtacggcgagaatgatctattcgctcttgctgcggcctat
ttgcatggcctcgttcggaaccatcctttttcagacggaaataaaagaacgggctatctg
gccgcctttacgtttctctacatcaacggctatctgatcgacacggacgatggaatgatt
gtcgccttcgtattgggcgtcgcagccggagaaatcgatgagacaggagcgacccacttt
ctcagagacttctccatcccgctaagcgactga

DBGET integrated database retrieval system