KEGG   Agrobacterium radiobacter: Arad_1742Help
Entry
Arad_1742         CDS       T00850                                 

Definition
(GenBank) Transcriptional regulator, AbrB family protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MazE_antitoxin CDC48_N
Motif
Other DBs
NCBI-ProteinID: ACM26102
UniProt: B9JCW5
Position
1:complement(1386731..1386952)
Genome map
AA seq 73 aa AA seqDB search
MNIVIRKIGNSEGVIIPKEVLQRLGLKSGDALEIREVNGTIELVPERADLAEQLRAARLG
MQKYRAALRELAK
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgtcatccgcaagatcggcaattccgagggcgtgatcattccgaaggaagtt
cttcaaagactcggcttgaaaagcggtgatgctctcgaaatacgtgaagtgaatggcact
atcgaactggttccagagcgcgctgaccttgctgaacaattgcgggcggcaaggctcggg
atgcaaaaatatcgcgcagccctgcgcgagctcgcaaaatga

DBGET integrated database retrieval system