KEGG   Agrobacterium radiobacter: Arad_1745Help
Entry
Arad_1745         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical membrane protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RDD
Motif
Other DBs
NCBI-ProteinID: ACM26105
UniProt: B9JCW8
Position
1:complement(1388865..1389323)
Genome map
AA seq 152 aa AA seqDB search
MSSNPSPLYAAPDDWRAYSGVLSRRIFAFIIDYVIVALLCIPAAVVLFFVSVLTLGLGFF
LYPVLFILVAGLYFGWTLGGPHQASLGMRAVGIAMVRVDGRRMDFLTAIVHLALFWILNS
VLTPLILLAGLFIERSRLIHDLLLGTVIVKTA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagctctaatcccagcccgctttatgcagcaccggacgactggcgcgcctatagtggc
gtgctgagccggcgcatcttcgcgttcatcatcgactacgtcatcgtcgctttgctctgc
attccggcggcagtcgttctgtttttcgtatcggtcctgacgcttgggctcggcttcttc
ctctaccccgtcctcttcatcctcgtggcgggcctttatttcggctggacgctcggcgga
ccgcaccaggcctcgctcggcatgcgcgccgtgggcatcgccatggtgcgggtcgatggc
cggcggatggatttcctgactgccatcgtgcatctggcgctgttctggatcctcaattcc
gtcctgacgccgctcatcctgctggcgggcctgttcatcgaacgcagccgcctgattcat
gacctgttgctcggcacggttatcgtcaaaaccgcctag

DBGET integrated database retrieval system