KEGG   Agrobacterium radiobacter: Arad_1773Help
Entry
Arad_1773         CDS       T00850                                 

Gene name
ihfA
Definition
(GenBank) integration host factor, alpha subunit
  KO
K04764  integration host factor subunit alpha
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ara03032]
    Arad_1773 (ihfA)
   03036 Chromosome and associated proteins [BR:ara03036]
    Arad_1773 (ihfA)
   03400 DNA repair and recombination proteins [BR:ara03400]
    Arad_1773 (ihfA)
DNA replication proteins [BR:ara03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Arad_1773 (ihfA)
Chromosome and associated proteins [BR:ara03036]
 Prokaryotic Type
  Nucleoid associated proteins
   IHF (integration host factor)
    Arad_1773 (ihfA)
DNA repair and recombination proteins [BR:ara03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Facilitator
      Arad_1773 (ihfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DNA_binding
Motif
Other DBs
NCBI-ProteinID: ACM26127
UniProt: B9JCZ0
Position
1:1406533..1406871
Genome map
AA seq 112 aa AA seqDB search
MTGKTVTRADLAESVFRKVGLSRTESAELVETVIDEICNAIVRGETVKLSSFATFQVRDK
NERIGRNPKTGEEVPISPRRVMTFKASNVLKTRILKAHASRKAKARPANPAS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaagacagtgacgcgcgcagacttggcggagtcggtattccggaaagttggc
ctctcccggaccgaatctgcggaactcgtcgagacggtgatcgatgagatttgcaacgcc
atcgtgcgtggcgaaactgtgaaactctcttccttcgcgacatttcaggtgcgcgacaag
aatgagcgtatcggtcgaaatccgaagaccggcgaagaggtaccgatctccccgcgtcgc
gtcatgaccttcaaggcgtccaacgtcctgaagacacgtatcctgaaggcccatgccagc
cgcaaggcgaaggcgcggccggcaaatcctgcttcctga

DBGET integrated database retrieval system