KEGG   Agrobacterium radiobacter: Arad_1774Help
Entry
Arad_1774         CDS       T00850                                 

Definition
(GenBank) transcriptional regulator protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR HTH_Tnp_1 HTH_17
Motif
Other DBs
NCBI-ProteinID: ACM26128
UniProt: B9JCZ1
Position
1:1407099..1407647
Genome map
AA seq 182 aa AA seqDB search
MTMDKSPDAFRTISEVAEDLDLPQHVLRFWETRFPQIKPMKRGGGRRYYRPEDVDLLNGI
RHLLYDHGYTIKGVQKLLKTNGNKFVIAVGHGDLASVEALAAAAQEPAPAEPRVGSGHPD
EDQIVGRAKAPISRRFFNFVSGEDDVPDVSLGKSSVGKEDRALLQETLYDLLECKRLLDQ
VR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggacaagagcccggatgcatttcgcacgatcagcgaagtcgcggaagacctt
gatctgccgcagcatgtcctgcgtttctgggaaacccgtttcccgcagatcaagccgatg
aagcgaggcggcggccggcgctattacaggcccgaggacgtcgatctgctgaacggcatc
cgccatctgctctatgatcacggctatacgatcaagggcgtccagaaactcctgaaaacc
aacggcaataaattcgtcatcgccgtcggccatggcgacctcgccagtgtcgaggcgctt
gccgccgccgcgcaggaaccggccccggccgagccgcgtgttggatccggccatcccgac
gaggatcagatcgtcggacgcgccaaggcgccgatcagtcgccgcttcttcaacttcgtc
agcggcgaagacgacgtgccggatgtttccctcggcaagtcgagcgtcggcaaggaagac
agggcgctgctgcaggaaacgctctacgacttgctggaatgcaagcggttgctcgaccag
gtgcggtag

DBGET integrated database retrieval system