KEGG   Agrobacterium radiobacter: Arad_1777Help
Entry
Arad_1777         CDS       T00850                                 

Gene name
ropAe
Definition
(GenBank) porin outer membrane protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_2
Motif
Other DBs
NCBI-ProteinID: ACM26130
UniProt: B9JCZ3
Position
1:1408316..1409416
Genome map
AA seq 366 aa AA seqDB search
MNIKSLLLGSAAALATVSGAHAADAIVAAEPEPLEYVRICDAYGTGYFFIPGTETCLKIG
GKVRTEGEWYDAYNPTNKVGTLWHERVELNVDTATDTEYGPLKTNMILRWEWNDGGATAD
KLLFANISLAGFTVGKLDSQYNLYTGYAGDVINDDAIYDGPYELNQLTYKYDTGSGFSAV
ISLEDSNSGSDSDSYGGAWVTSKADQYAPNVVAGLGYTTDTLGFKVVGGYDSIVEEGAIK
ARVDAKFGGVEAFLMGGWNTDGKKLNQYAGSYQDESACTTSDGVVHGAKCGWGDWAVWGG
VGVPVNDKLKWNLQLAYTDSKIFEATTNLKFNPVKDLLIEPELTYMHYDFINDDTVAGIL
RFERNF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaagagccttcttctcggctccgctgccgcgctggcaacggtgagcggcgcc
catgcggccgatgccatcgttgcggccgaacccgagcctctggaatatgtccgcatctgc
gatgcctacggcaccggctatttcttcattccaggcaccgagacctgcctgaagatcggt
ggcaaggttcgcaccgagggtgagtggtacgacgcctacaatccgacgaacaaggtcggt
acgctctggcatgagcgcgtcgagctcaatgtcgatacggcgacggacacggaatatggt
ccgctgaagaccaacatgatcctgcgctgggaatggaacgatgggggtgccacagccgat
aagctgctgtttgccaatatcagccttgccggcttcaccgtcggcaagctcgactcgcag
tataatctctatacgggctatgctggcgacgtcatcaacgatgatgcgatctatgatggc
ccgtacgaactcaaccagttgacctacaaatatgataccggctccggtttctccgccgtc
atctcgctagaagacagcaattcggggtctgactcggacagctacggcggcgcctgggtt
acctcaaaggccgatcaatatgcgcccaacgtcgttgccggtctggggtatacgaccgac
acgctcggcttcaaggtcgtcggcgggtatgactccatcgtcgaagaaggcgccatcaag
gctcgcgtcgacgccaagttcggcggcgtggaagctttcctgatgggcggctggaacacg
gatggcaaaaagctcaaccagtatgccggctcctatcaggatgaatcggcctgcacgacc
tccgatggcgtcgtccatggggcaaagtgcggctggggagattgggccgtctggggcggc
gttggcgtaccggtcaacgacaagctgaagtggaacctgcagcttgcctataccgactcg
aagatcttcgaagcaacgacgaacctgaagttcaacccggtcaaggatctgctcatcgag
ccggaactgacctacatgcattatgatttcatcaacgatgacaccgttgccggcattctg
cgtttcgagcggaatttctga

DBGET integrated database retrieval system