KEGG   Agrobacterium radiobacter: Arad_1783Help
Entry
Arad_1783         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACM26135
UniProt: B9JCZ8
Position
1:1412061..1412273
Genome map
AA seq 70 aa AA seqDB search
MLETSIHPQDLPLFSDDLDRLEKVLDIVCKDRGIDHRGPEAERLGALIIQLYRQGVKEDA
KLVALARAYL
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaacctcaatccatccccaggatctacccctgttttcggacgatctggatcgt
ctggagaaggtgctggatatcgtctgcaaggatcgcggcatcgatcatcgcggcccggaa
gctgagcgtctcggcgcgctgatcatccaactttatcgccagggcgtgaaggaagacgcg
aagcttgtcgcgcttgctcgagcctatctctga

DBGET integrated database retrieval system