KEGG   Agrobacterium radiobacter: Arad_1786Help
Entry
Arad_1786         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K19686  ribonuclease VapC [EC:3.1.-.-]
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:ara02048]
    Arad_1786
Enzymes [BR:ara01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Arad_1786
Prokaryotic defense system [BR:ara02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   VapC-VapB
    Arad_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN
Motif
Other DBs
NCBI-ProteinID: ACM26137
UniProt: B9JD00
Position
1:complement(1413525..1413956)
Genome map
AA seq 143 aa AA seqDB search
MFIDASVIVAILNQEPGWQELAKRLAHVENACAVSPLVRFEAMLGIARAAVHKRSGPGTK
PDPMILQESRKLVDDLIAEIGATEIAITNTVGNGAMDAAAMYGKAIGHPADLNFGDCFAY
ACAKACGSGLLYKGDDFAQTDLA
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgttcatagacgcatcggtcattgtcgcaatcctcaaccaggaacccggctggcaggag
ctcgctaaaaggctcgcgcatgtcgaaaatgcctgtgcagtgtctccgctcgtccgtttc
gaagcgatgctgggcattgcgcgggctgccgttcacaagcgcagcgggccgggtacgaaa
ccagaccctatgattttgcaggagtctcgcaagctggtggatgacttaattgctgaaatt
ggtgcaacagaaattgccatcacgaacaccgttggcaacggagcgatggacgcagctgcg
atgtacggaaaagcaatcggccatccggccgatctcaattttggtgactgtttcgcgtat
gcttgcgcaaaagcgtgcggaagcggccttctatataaaggcgacgattttgcgcagact
gatctagcttga

DBGET integrated database retrieval system