KEGG   Agrobacterium radiobacter: Arad_1792Help
Entry
Arad_1792         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzy_C
Motif
Other DBs
NCBI-ProteinID: ACM26142
UniProt: B9JD05
Position
1:complement(1415859..1417121)
Genome map
AA seq 420 aa AA seqDB search
MTAIDLPFPRVDRPQLATLRLIGTACVAFGVFLSGFVIAEPAPYELWLAFLIGTWFILGL
KISRSTAPLLALFLAFNVGGMLSLTQMRDLGASDHLDGPVYIAVSTFLALSAVFYAAIIE
DSEKRLKLIFNTWVVAALITASLGILGYFHAVPGFGIFTRYDRAMGAFQDPNVFGPYLVT
PTIFLMHGILIGDLKKAPIKALCLIVLAFGIFLSFSRAAWALFAFASVMLIFCMLLKHRS
NAFRLRILVMSLTAIVLMVVVLIVALQFHQVSDLFSTRTQLVQDYDGGHLGRFERHRLGF
MMSMERPLGIGPLVFSTLFREDEHNIWLKTLTTYGWLGFFCWVSMICWTIYIGFRNLLKE
RPWQPYVMIAWIVILGHVGIGNVIDTDHWRHLYMLIGIVWGCGALEQHHQRGLTRREAAP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcgatcgatctccccttcccgcgcgtcgaccggccgcagcttgccacgcttcgg
ctgatcggcacggcctgcgtcgccttcggggtgttcctgtcgggtttcgtcatcgccgag
cccgcgccctatgagctgtggctcgcctttctcatcggcacctggttcatcctcgggctg
aagatctcgcgcagcaccgcgccgctgctggctctcttcctggccttcaatgtcggcggc
atgctgtcgctgacgcagatgcgcgatctcggcgccagcgaccatctcgacggtccggtc
tatatcgccgtctccaccttcctggcgctgagcgccgtcttctacgccgcgatcatcgag
gacagcgaaaaacggctgaagttgatcttcaacacctgggtcgttgccgcgctgatcacg
gcgagccttggcatactcggctatttccacgctgtccccggcttcgggattttcacgcgc
tacgaccgcgccatgggcgcatttcaggatccgaacgtcttcggtccctatctggtgaca
ccgaccatctttctcatgcatggcatattgatcggcgatctcaagaaggcgccgatcaag
gcgctatgcctgatcgtcctggccttcggcatctttctctccttctcgcgtgccgcctgg
gcgctgttcgcctttgcctcggtaatgctgatcttctgcatgttgctgaagcatcgcagc
aacgcctttcggttgcgcatcctcgtgatgtcgctgacggcaattgttctcatggtcgtc
gtgctgattgtcgcactgcaattccatcaggtcagcgacctgttctcgacgcgcacgcag
ctcgtgcaggattatgacggcggacatctcggccgcttcgagcggcatcgcctcggcttc
atgatgtcgatggaaaggccgctcggtatcgggccgctggtgttctccaccctctttcgc
gaggacgagcacaatatctggctgaagacgctgaccacctatggctggctcggcttcttc
tgctgggtcagcatgatctgctggaccatctatatcggcttccgcaaccttttgaaggag
cggccctggcagccttacgtgatgatcgcctggatcgtcattctcggccatgtgggtatc
ggcaacgtcatcgataccgaccattggcgccatctctacatgctgatcggtatcgtctgg
ggctgcggggcgctggagcaacatcatcagcgtggcttgacccgaagggaagcggcgccg
tga

DBGET integrated database retrieval system