KEGG   Agrobacterium radiobacter: Arad_1818Help
Entry
Arad_1818         CDS       T00850                                 

Definition
(GenBank) O-acetylhomoserine sulfhydrylase protein
  KO
K01740  O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00270  Cysteine and methionine metabolism
ara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Arad_1818
Enzymes [BR:ara01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     Arad_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_1_2 Aminotran_5 GDC-P
Motif
Other DBs
NCBI-ProteinID: ACM26159
UniProt: B9JD22
Position
1:1435356..1436639
Genome map
AA seq 427 aa AA seqDB search
MATNNPGFDTLAIHAGAQPDPTTGARTTPIYQTTSFVFQDADHAAALFGLQQFGNIYTRI
MNPTQAVLEERVAALEGGTAGLAVASGHAAQLLVFHAIMQPGDNFVAAKRLYGGSINQFG
HSFQNFDWHVRWADSDDPATFEAQIDGRTRAIFIESLANPGGTFVDIAAIAAIARKHGLP
LIVDNTLASPYLIRPLEHGADIVVHSLTKFIGGHGNSMGGVIIDGGTFDWSASGNYPMLS
TPRPEYNGIVLHATFGNFAFAIACRVLGLRDLGPAISPFNAFLILTGIETLPLRMQRHSD
NAIAVARWLKGHDKVVWVNYAGLEDHPNHALQQRYSPKGAGSVFTFGLKGGYEAGKGFVE
ALELFSHLANIGDTRSLVIHPASTTHKQLTDEQRIGAGAGPDVVRLSIGIEDVKDIIADL
EQALAKV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaacaatccaggtttcgacacactggcgatccatgcgggtgcgcagccggac
ccgacgacgggtgcccgcacgacgccgatctaccagacgacctccttcgtctttcaggat
gcggatcatgccgctgcactcttcgggttgcagcagttcggcaatatctatacccgcatc
atgaacccgacccaggcggtgctggaggagagggtggcggctctcgaaggcggcacggcg
ggccttgcggttgcctccggccacgccgcccagttgcttgtcttccacgccatcatgcag
ccgggcgataatttcgtcgcggccaagcgtctctatggcggctcgatcaatcagttcggc
cattccttccagaatttcgattggcatgtacgctgggccgacagcgatgatcccgccacc
ttcgaggcgcagatcgacggacgcacccgcgccatcttcatcgaaagtctcgcaaatccc
ggcggcaccttcgtcgatatcgcggccattgccgccattgcccgcaagcacggcctgccg
ctgatcgtcgacaataccctggccagtccctatctcatccggccactggagcatggcgcc
gatatcgtcgtgcattcgctgaccaaattcatcggcggtcacggcaactccatgggcggc
gtgatcatcgatggcggcaccttcgactggtccgcctcgggcaactatccgatgctgtca
acgccgcggccggaatataacggcatcgtgctgcacgcgaccttcggcaatttcgccttc
gccatcgcctgccgcgtccttggccttcgcgatctcggccccgccatttcacccttcaac
gccttcctgatcctgaccggcatcgagacgctgccgctgcgcatgcagcgccattccgac
aatgcgattgccgtcgcccgctggctgaaggggcacgacaaggtggtctgggtaaattat
gccggcctcgaggatcacccgaaccacgcgttgcagcagcgctattcgccaaagggggcg
ggctccgtctttaccttcggcctgaagggcggttatgaggcaggcaagggcttcgtggag
gctctggaactgttctcccatctcgccaatatcggcgacacccgctcgctggtgatccat
ccggcctcgacgacgcacaagcagctcaccgacgaacagaggattggcgccggcgccggc
cccgatgtggtgcgcctgtcgatcggcatcgaggacgtcaaggacatcatcgccgacctg
gagcaggccctggcgaaggtttga

DBGET integrated database retrieval system