KEGG   Agrobacterium radiobacter: Arad_1821Help
Entry
Arad_1821         CDS       T00850                                 

Definition
(GenBank) periplasmic phosphate-binding protein, (PBP)
  KO
K02040  phosphate transport system substrate-binding protein
Organism
ara  Agrobacterium radiobacter
Pathway
ara02010  ABC transporters
ara02020  Two-component system
Module
ara_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:ara00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Arad_1821
  09132 Signal transduction
   02020 Two-component system
    Arad_1821
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ara02000]
    Arad_1821
Transporters [BR:ara02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    Arad_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 PBP_like SBP_bac_11 DUF4992
Motif
Other DBs
NCBI-ProteinID: ACM26162
UniProt: B9JD25
Position
1:1438537..1439562
Genome map
AA seq 341 aa AA seqDB search
MLNQKFRSLCLTAGFIAAMSVSASAADITGAGSSFIAPVLSKWAEGYKAATNNVVNYQSV
GSGAGIKQLLDKTIVFGASDKPMSDADLEKNGIAQFPMISGGIVVSYNVEGVKPGELVLD
GKTLSDIFLGKIAKWDDAAIKALNPDVKLPSTPISVVYRADSSGTTFNFTDYLAKVSPEW
KEKVGSNTAVEWPVGFGAKGSEGVSTTVNQTAGSISYVEYSYVIANHIGFAKMKNAAGKV
IEPSLETFKAAASNADWANAKNFNLIITNQPGDQSWPIAASTWVLLYKKPADPALNEEAL
KFFKWSYEHGQKDATALSYLAIPESVAAVVEKSWTKDFGAK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaccagaaatttcgttcgctttgcctgacggcaggcttcatcgctgccatgtcc
gtttcggcctcggctgccgacatcacaggcgctggctcgagcttcatcgcgccggttctg
tccaagtgggctgaaggctacaaggctgcgacgaacaatgtcgtcaactaccagtctgtc
ggttcgggcgccggcatcaagcagctcctcgacaagaccatcgtattcggcgcttcggac
aagccgatgagcgacgctgacctcgagaagaacggcattgcccagttcccgatgatctcc
ggcggcatcgtcgtttcctataatgttgaaggcgtaaagccgggcgaactcgttctcgac
ggcaagacgctgtccgacatcttcctcggcaagatcgccaagtgggacgatgcggccatc
aaggccctcaaccccgacgtcaagctgccttccacgccgatctccgtcgtttatcgcgcc
gacagctcgggcacgaccttcaacttcaccgactacctggcgaaggtttcgccggagtgg
aaggaaaaggttggttcgaacacggcggttgaatggccggtcggcttcggcgccaagggt
tccgaaggcgtttccaccactgtcaaccagacagctggttcgatctcctacgttgaatat
tcctacgtcatcgccaaccacattggtttcgcgaagatgaagaatgctgccgggaaggtt
atcgagccgagcctcgagacattcaaggctgctgcttccaacgccgattgggccaacgcc
aagaacttcaacctcatcatcaccaatcagccgggcgatcagagctggccgattgcagct
tcgacctgggttctgctctacaagaagccggccgatcctgctctcaacgaagaagcgctg
aaattcttcaagtggtcctatgagcacggacagaaggacgcgaccgccctgtcctatctt
gcgatcccggagagtgttgccgcggttgtcgagaagtcctggacgaaggactttggcgcg
aagtaa

DBGET integrated database retrieval system