KEGG   Agrobacterium radiobacter: Arad_1823Help
Entry
Arad_1823         CDS       T00850                                 

Gene name
pstC
Definition
(GenBank) phosphate ABC transporter, permease protein PstC
  KO
K02037  phosphate transport system permease protein
Organism
ara  Agrobacterium radiobacter
Pathway
ara02010  ABC transporters
Module
ara_M00222  Phosphate transport system
Brite
KEGG Orthology (KO) [BR:ara00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Arad_1823 (pstC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ara02000]
    Arad_1823 (pstC)
Transporters [BR:ara02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    Arad_1823 (pstC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACM26163
UniProt: B9JD26
Position
1:1439638..1440609
Genome map
AA seq 323 aa AA seqDB search
MADATQTAGFQALDTSAVTRKFRIQDRIFYFMTFGSAALVVLLLLAIIVVLIIDALPTFQ
AFGFSFLWGTKWSAPADIYGAVPAVVGTLVSSLIAMLIAVPLGIGIAIFLTELCPGSLRR
PISTAIELLAGIPSIIYGIVGLFILVPLMQTYILPFLMMTIGQVPVIGLLFQPPAPGVGL
LTASLVLAIMILPFITAISRDVFSTVPPMLRESAYGTGMTTWEVARHILIPYTRRGLVGG
IMLGLGRALGETMAVTFVIGSVSRLQSSIISPSTTISAQIANNFGDADGLQLSSLIALGL
LLFVLSFCVLAVARWMIGRGNAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcgactcagacggctggcttccaggcactggataccagcgccgtcaccaga
aaattccggatacaggatcgaattttctattttatgacgtttggctcggctgctcttgtc
gtgcttctgctgctggcaatcatcgtggttctcatcatcgatgccttgccaaccttccag
gccttcgggttttcgttcctctggggcacgaagtggagcgctcccgccgatatttatggt
gctgtccctgccgtggtcggtacgctggtgagttcgctcatcgccatgctgatcgccgtt
cccctgggcatcggcatcgccatcttcctcacggaactttgccccggcagcctgcgacgt
ccgatcagtacggccatcgagcttctggccggtattccctccattatctacggcatcgtc
ggcctcttcattctcgtgccgctgatgcagacctatatcctgcccttccttatgatgacg
atcggccaggtgccggtgatcggcctgctgttccagccgccggcgccgggcgtcggcctg
ttgacggcaagcctcgtgctggccatcatgatcctgccgttcatcaccgcgatctcccgc
gacgtgttcagcaccgtgccgccgatgctgcgtgaatccgcttacggcacgggcatgacc
acatgggaagtggcccgccacatcctgatcccctatacacgtcgcggcctcgtcggcggc
atcatgctcggcctcggccgcgcgcttggcgaaaccatggccgtcacgttcgtcataggt
tcggtcagccgtctgcaatcgtcgatcatctcgccgtccaccaccatttccgcccagatc
gcgaacaacttcggcgacgccgacggtctgcaattgtcgagcctgattgcgctcggcctg
ctcctgttcgtcctttccttctgcgtgcttgcggtggcgaggtggatgatcggtcgcggc
aacgcgctttga

DBGET integrated database retrieval system