KEGG   Agrobacterium radiobacter: Arad_2352Help
Entry
Arad_2352         CDS       T00850                                 

Definition
(GenBank) sugar ABC transporter
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
ara  Agrobacterium radiobacter
Pathway
ara02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ara00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Arad_2352
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ara02000]
    Arad_2352
Enzymes [BR:ara01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     Arad_2352
Transporters [BR:ara02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Arad_2352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_23 RsgA_GTPase AAA_30 DUF815 AAA_16 MMR_HSR1 AAA_27
Motif
Other DBs
NCBI-ProteinID: ACM26566
UniProt: B9JF76
Position
1:1857527..1859107
Genome map
AA seq 526 aa AA seqDB search
MRTAVPRFLYRSIQGNSCSMAHDVERLLTATGFCKYFPGSTALDHVDFTLRRGEVHALLG
ENGAGKSTLIKCMTGAYRRDAGSLALDGVEIDPHDTLAAQKLGIGTVYQEVNLLANLSVA
ENLFLGRQPKRFGMISTRVMNVMAKDLLSQYGIDIDVSRQLDRFSVAIQQVIAIARAVDL
SGKVLILDEPTASLDTQEVAMLFGIIRNLKQRGLGIVFITHFLEQVYEICDRITVLRNGR
LVGTRDAEGLSRQTLIAMMLGRELAEVEASVKEAASDSGPAKYHFTNFGKRGKIKPFDLE
VRVGEVVGIAGLLGSGRTETAEVMFGVERADSGEARIDAQSVTLSSPRAAIKNGFGFCPE
DRKTDGIIGDLSIRENIVMALQARRGWARPLSRGEQNAIADRYIKALDIRTTDREKPIRL
LSGGNQQKAILARWLATNPSFLILDEPTRGIDVGAHAEIIRLIEDLCRQGMSLVVISSEL
EELVAYSSRVIVLRDREHIAELTGSDITASHIVDAIATAQSKREDA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacggcagttccgcgttttttataccgctcaatccaaggaaattcttgctccatg
gctcacgatgtcgagcgccttctgaccgcgactggtttctgcaaatattttcccggttcc
accgcccttgaccatgtcgatttcacgctgcggcgaggcgaggtccatgcgcttctcggt
gaaaacggtgcagggaagtcaacactcatcaaatgcatgaccggagcataccgtcgcgac
gccggcagccttgctctcgatggcgtcgagatcgatccgcacgacacgctggcggcgcag
aagctcggtatcggcacggtctatcaagaggtgaacctccttgccaatctgagtgttgcg
gagaacctgtttctcggtcgccagccgaagcgcttcggcatgatcagcacccgcgtgatg
aacgtcatggcgaaggatctgttgtcgcaatacggtatcgatatcgatgtcagccggcag
ctggatcgcttctccgtcgcgatccagcaggtgattgcgatcgcgcgtgccgtcgatctc
tcgggcaaggtcctcatcctcgacgagccgaccgcgagcctggatacccaggaagtcgcc
atgcttttcggcatcatccgaaatttgaagcagcgcggattggggattgttttcattacg
cattttttggagcaagtctacgagatctgcgaccgtattaccgttctccgcaatggtcga
cttgtcggcacccgcgatgcggagggcctgtcacgccagaccctgatcgcaatgatgctg
ggccgcgaacttgccgaagtcgaggcgagcgtgaaggaggcagccagcgatagcgggcct
gcaaagtatcatttcaccaatttcggcaaacgcggcaagatcaagcccttcgaccttgag
gttcgcgtcggcgaggtggtgggcattgccggcctgctcggttccgggcgcacggaaacc
gccgaagtgatgttcggcgtcgagcgcgccgacagcggcgaggcaaggatcgatgcgcag
tcggtgaccctttcgtcaccgcgcgccgccatcaagaatggctttggtttttgcccggaa
gaccgcaagacggatggcatcatcggcgatctttccattcgcgagaatatcgtcatggcg
cttcaggcccgtcgcggctgggcgcgcccgctgtcacgcggcgagcagaacgcgatcgcc
gaccgctacatcaaggcgctggatattcgcaccaccgaccgggaaaagccgatcaggctt
ctgtccggtggcaatcagcagaaggccattctggcccgctggctggcgaccaatccgagc
ttcctcattctcgatgaaccgacgcgcggcatcgatgtcggcgcgcatgctgaaattatt
cggctgatcgaggatctctgccggcagggcatgtcgctggtggtgatttcctccgaactg
gaggaactcgtggcctatagctctcgcgtcatcgtgctgcgcgatcgcgagcatattgca
gagttgaccggcagcgacataaccgccagccatatcgtcgatgccatcgccacggcgcag
agcaagcgggaggacgcatga

DBGET integrated database retrieval system