KEGG   Agrobacterium radiobacter: Arad_4263Help
Entry
Arad_4263         CDS       T00850                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00900  Terpenoid backbone biosynthesis
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Arad_4263 (dxr)
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Arad_4263 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: ACM28006
UniProt: B9JBW0
Position
1:3398748..3399941
Genome map
AA seq 397 aa AA seqDB search
MTTGSKAKRRLTILGSTGSIGQNTLDVIAQLGGRDAFEIAAITGHDNIDLLASQAKACGA
ALAVTANEDRYQALKDALAGTGIAAAAGRNALIEAASIPSDWVMAAIVGTAGLAPTLEAA
RRGADIALANKECLVSAGDLFVRAVAEGGGRLIPVDSEHSAIFQALEDDQQHAVERIILT
ASGGPFRTWSREQMANVTPATARAHPNWSMGFKISIGSASMFNKALEMIEAKHLFNVRPE
QIEVVVHPQSVIHSMVGYTDGSVLAQLGCPDMRTAIGYALTYPSRTKLDVERLDFTKLAR
LDFEAPDEVRFPALRLARTAMERGGLQGAIMNAAEEIAFHAFVDGRIGFLEMADIAEAVM
DQMIATGTAETMDAVFAADEEARRRAGVLVAQREKAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgggagcaaggccaaacgccgcctgacgatattgggttcgaccggctcgatc
ggccagaacacgctcgacgtcattgcccaactgggcggacgcgacgccttcgaaatcgca
gcgatcaccggacacgacaatattgacctcctggcaagccaggcgaaagcctgtggcgca
gcacttgccgtcaccgccaatgaagaccgctatcaggcgctgaaggatgccctagccggc
accggcatcgccgcggccgcaggccggaacgcattgatcgaggctgcctccattccctcg
gactgggtaatggcggcaatcgtcggcacggcgggcctggcgccaacgctggaagccgcg
cggcgaggcgccgatatcgcacttgccaacaaggaatgcctggtctcagccggcgatctt
ttcgtgcgcgccgtcgcagaaggcggcggacggctgatcccggtcgacagcgaacacagc
gctattttccaggcgctggaggacgaccagcagcatgcggtggaacgcatcatcctgaca
gcctccggcggccccttccgcacctggtcgcgtgagcagatggccaatgtcacgccggca
accgcgcgcgcgcatcccaactggtccatgggcttcaagatctccatcggcagcgcctcg
atgttcaacaaggcgctcgagatgatcgaggccaagcacctgttcaatgtccgcccggaa
cagatcgaggtcgtcgtccatccgcaatccgtcatccattccatggtcggctatactgac
ggctcggtgctggcgcagctcggctgtcctgatatgcgtaccgctatcggctatgcgttg
acctatccgtcccgcacgaaactcgacgtcgagcggctggatttcaccaagctggcgcgg
ctggatttcgaggctccggatgaagttcgcttcccggcgctgcgtttggcgcgtaccgcc
atggagcgcggcggactgcagggcgccatcatgaacgcggccgaggaaatcgctttccat
gccttcgtggatggccgtatcggcttcctggaaatggccgacatcgccgaagccgtgatg
gaccagatgatcgccaccggcaccgccgaaacgatggatgcggtctttgccgccgatgag
gaggcgcgccgtcgcgcgggcgtccttgtggctcaacgggaaaaggccgcgtag

DBGET integrated database retrieval system