KEGG   Agrobacterium radiobacter: Arad_4554Help
Entry
Arad_4554         CDS       T00850                                 

Definition
(GenBank) thiolase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00071  Fatty acid degradation
ara00072  Synthesis and degradation of ketone bodies
ara00280  Valine, leucine and isoleucine degradation
ara00310  Lysine degradation
ara00362  Benzoate degradation
ara00380  Tryptophan metabolism
ara00620  Pyruvate metabolism
ara00630  Glyoxylate and dicarboxylate metabolism
ara00640  Propanoate metabolism
ara00650  Butanoate metabolism
ara00900  Terpenoid backbone biosynthesis
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
ara01200  Carbon metabolism
ara01212  Fatty acid metabolism
ara02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Arad_4554
   00630 Glyoxylate and dicarboxylate metabolism
    Arad_4554
   00640 Propanoate metabolism
    Arad_4554
   00650 Butanoate metabolism
    Arad_4554
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Arad_4554
   00072 Synthesis and degradation of ketone bodies
    Arad_4554
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arad_4554
   00310 Lysine degradation
    Arad_4554
   00380 Tryptophan metabolism
    Arad_4554
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Arad_4554
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arad_4554
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Arad_4554
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ara04147]
    Arad_4554
Enzymes [BR:ara01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Arad_4554
Exosome [BR:ara04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arad_4554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACM28241
UniProt: B9JDB2
Position
1:complement(3650014..3651204)
Genome map
AA seq 396 aa AA seqDB search
MSAIDPVVIVSATRTPLGRFQGELSSLQAPELGAHVIRAALERAGLSAEKVDEVLFGCVL
PAGQGQAPARQAARGAGLPDAVGATTINKVCGSGMKATMLAHDLILAGSVSIAVSGGMES
MSNAPYLLAKARGGYRMGHDRIFDHMMLDGLEDAYEKGRSMGDFGELAVEAYQFSRDDQD
AYAVESLTRARKAIETGAFEAEITPISVAAKGGPVTIGKDEHPQKVSPEKIPTLKPAFRK
DGTITAASASANADGAAALILTRRSIAEREGLPILAEIKAHATHSQEPAWYTTAPIPAIR
KVLEKTGWKVGDVDLFEINEAFAVVAMAAAKDLGIARDRLNINGGACALGHPIGATGARL
IVTLLHALERQGARRGVAALCIGGGEATAIAVERVG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaatcgatcccgtcgtcatcgtttccgccacgcgcacgccgcttggccgcttc
cagggggagctgtcatccttgcaggcgccggagcttggcgcccatgtcatccgcgccgcg
ctggagcgggccggattatcggcggagaaggtggatgaggtgctgttcggttgcgtgctc
ccggcaggacaggggcaggcgccggcgcggcaggcggcgcgcggtgcgggattgccggat
gcggtcggcgccacgaccatcaacaaggtctgcggttccggcatgaaggcgaccatgctg
gcgcatgatctgattctcgccggttccgtttccatcgcggtctccggcggcatggaatcg
atgtccaacgccccctatctgctcgccaaggcgcgcggcggttaccgtatgggccatgac
cgcattttcgaccacatgatgctcgacgggctggaggatgcctacgagaagggccgttcg
atgggcgatttcggcgagctggcggtcgaagcctatcagttcagccgcgacgatcaggat
gcctatgctgttgagagcctgacgcgtgcccgcaaagccatcgagaccggcgccttcgag
gccgagatcaccccgatttccgtcgctgccaagggcggcccggtgacgatcggcaaggac
gagcatccgcagaaggtttcgccggaaaagatcccgacgttgaaaccggcgttccgcaag
gacggcacgatcaccgccgccagcgcctcggccaatgccgatggtgccgctgccctgatc
ctgacccggcgctcgatcgccgagcgcgaaggtctgccgatcctcgccgagatcaaggcg
cacgccacccattcccaggaacccgcctggtacacgacggcgccgatcccggcgatccgc
aaggtgctggaaaagaccggctggaaggtcggcgatgtcgatctcttcgagatcaacgag
gccttcgccgtcgtcgccatggccgccgccaaggacctcggcatcgcccgcgaccgtctc
aacatcaacggcggcgcctgcgcgctcggccacccgatcggcgccacgggcgcacggctg
atcgtgacgctgctgcatgcgctggagcgccagggcgcaaggcgcggcgtcgcggcactc
tgcatcggtggcggcgaggcgacggcgattgctgtggagcgggttgggtga

DBGET integrated database retrieval system