KEGG   Agrobacterium radiobacter: Arad_8238Help
Entry
Arad_8238         CDS       T00850                                 

Definition
(GenBank) aldehyde dehydrogenase protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00010  Glycolysis / Gluconeogenesis
ara00053  Ascorbate and aldarate metabolism
ara00071  Fatty acid degradation
ara00280  Valine, leucine and isoleucine degradation
ara00310  Lysine degradation
ara00330  Arginine and proline metabolism
ara00340  Histidine metabolism
ara00380  Tryptophan metabolism
ara00410  beta-Alanine metabolism
ara00561  Glycerolipid metabolism
ara00620  Pyruvate metabolism
ara00625  Chloroalkane and chloroalkene degradation
ara00903  Limonene and pinene degradation
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_8238
   00053 Ascorbate and aldarate metabolism
    Arad_8238
   00620 Pyruvate metabolism
    Arad_8238
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Arad_8238
   00561 Glycerolipid metabolism
    Arad_8238
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arad_8238
   00310 Lysine degradation
    Arad_8238
   00330 Arginine and proline metabolism
    Arad_8238
   00340 Histidine metabolism
    Arad_8238
   00380 Tryptophan metabolism
    Arad_8238
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arad_8238
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Arad_8238
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Arad_8238
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Arad_8238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACM29562
UniProt: B9JI20
Position
2:complement(1089270..1090697)
Genome map
AA seq 475 aa AA seqDB search
MSHNLQFFIDGQWVAPVTPKTLDVIDPSTEEAYTQISIGSAADVDKAVKAAKSAFESFSL
TTKAERLALLKRILAAYNDRFEDIAQAVSQEMGAPLPFARDSQAWAGRGHMEATIAAFES
YEFEAKRGVTTVVKEPIGVCALITPWNWPLNQIVCKVAPAIAAGCTVVLKPSEIAPISGI
VFAEVMEAAGTPKGVFNLVNGNGPEVGQVMAGHPDVDMVSFTGSTRAGIIVAKTAADTVK
RVAQELGGKSANIILPDADFETAVTKGVSGCFGNSGQSCDAPTRMLVPAARHDEALAIAK
IAAEKFKVGDPRAEGTDLGPVVSQIQYDKIQRLIEAGIKEGATLVTGGLGRPEGLNRGYY
IRPTIFGHVTNDMTIAREEVFGPVLSIISYEDEDDAVRIANDTVYGLAAYVQSTDIAHAR
KVALRMRAGSVYLNYPDWDTFAPFGGYKQSGNGREYADWAIHDFLEIKGVVGWGE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagccataacctgcaattcttcatcgacggacaatgggtggccccggtcacgccgaag
acgctcgatgtcatcgatccctcgaccgaggaggcctatacgcagatctccatcggctcc
gcagccgacgtcgacaaggccgtcaaggcagccaaatccgccttcgaaagcttttccctg
accaccaaggccgagcgtctggcgctcttgaagcggattctggcggcctataacgaccgc
ttcgaggatattgcgcaggcggtcagccaggaaatgggagcgcctttgcccttcgcgcgc
gactcccaggcctgggccggtcgcgggcatatggaggcaacgatcgccgcctttgaaagt
tatgaattcgaggcaaagcgcggcgtgaccacggtcgtcaaggagccgatcggcgtctgc
gcgctgatcaccccctggaactggccgctgaaccagatcgtctgcaaggtcgcgccggca
atcgccgccggctgcaccgtagtgctcaagccgtccgaaatcgcgccgatcagcggcatc
gtctttgccgaagtcatggaagcggcgggcacgccgaaaggcgtcttcaacctcgtcaac
ggcaacggccccgaggtcgggcaggtcatggccggccatccggacgtcgatatggtttcc
ttcaccggctcgacccgcgccggcatcattgtcgccaagaccgcggccgataccgtcaag
cgcgtggcgcaggagctcggcggcaagtcggcgaacatcatcctccccgatgctgatttc
gagaccgccgttaccaagggcgtttccggctgcttcggcaactccggccagtcctgcgac
gccccgacgcgcatgctggtgccggccgcgcgtcacgatgaagccctcgcgattgccaag
attgcagctgaaaaattcaaggtcggcgatccgcgcgccgagggcaccgatctcggcccg
gtcgtcagccagatccagtacgacaaaatccagcggctgatcgaggccggcatcaaggaa
ggcgccacactggtgaccggcggcctcggccggccggaagggctgaaccgcggctactac
atccgcccgacgatcttcggccacgtcaccaacgacatgaccatcgcccgcgaagaggtt
ttcgggccggtgctctcgatcatttcctacgaagacgaggacgacgcggttcgcatcgcc
aacgacaccgtctatgggcttgccgcctatgttcagtcgacggatatcgcccatgcccgc
aaggtggcactgcgcatgcgcgccggatccgtttatctcaactatccggactgggatacg
tttgcgccctttgggggctacaagcagtcgggcaacggccgtgaatatgccgactgggcg
atccacgatttcctcgagatcaagggcgtcgtcggctggggtgaatag

DBGET integrated database retrieval system