KEGG   Agrobacterium radiobacter: Arad_8317Help
Entry
Arad_8317         CDS       T00850                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00052  Galactose metabolism
ara00561  Glycerolipid metabolism
ara00600  Sphingolipid metabolism
ara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Arad_8317
  Lipid metabolism
   00561 Glycerolipid metabolism
    Arad_8317
   00600 Sphingolipid metabolism
    Arad_8317
Enzymes [BR:ara01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Arad_8317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_31 GHL10 Melibiase_2
Motif
Other DBs
NCBI-ProteinID: ACM29622
UniProt: B9JI80
Position
2:1159597..1161687
Genome map
AA seq 696 aa AA seqDB search
MSKTVVIKAGAVSLALGLPVSGMPEILGFGRGALAPEFWPDVPRSSRVNGMDIAVPSNVL
LPVGGLGFFGWPAISGHRDGHSFILEFGNWQAEEIASGVILKAEDPVAEIGLRICIEASP
AEVLSISTSLTNLGSGDYTLDRCMAASFLMPAGAAELTTFTGMWGREFQTRHTAIADGLW
MQESRRGRTSHDRFPFAFLECGGERMGFHLGWSGNHLMAIDTLDDERRLVHLGELFEPGE
IRLATGETYASPTAFAGPDSEAFHAFVRESVIAWPGGEMKPRPVTLNTWEGNYCDHRMDS
LKAQADAAAAVGIERFVLDDGWFGKRDDDTTSLGDWFIDERKYPDGLKPLVDHVTSLGME
FGLWFEPENVNPESELFRAHPDWALQVEGRPLLLSRNQLVLDLTRPEVSDYLFRCMEAVL
SQHAIAYIKWDMNRDLTHAGGADGRARTAQQTRAVYALMDRIRQAFPAVEIESCASGGGR
IDYGVLRHTHRVWTSDCTDAFERLEIQHGASRFVPPELLGAHIAASPNHQTGRRLTLSFR
ALVALAYHLGVELNPLALDAEEKQELEGWIALHKSLRPLLHAPGKQFRLPPLDGRYVWGA
ADESRIVAFVAQGPQMVGEQPAPVRLPVSGEGAGKWRVKAIHPAEPEFIRISEGQQRLLN
GELTFSLDTLRHVGLPLPMLRPESGLLLEFEPVTGD
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactgttgttatcaaagccggcgcggtgtcgctggcgctcggcctgcctgta
agcggcatgccggagattctcggcttcggtcgcggagcgcttgcgccggaattctggcct
gacgttccgcgttcgagccgtgtcaacggcatggatatcgctgtgccgtcgaatgttctg
ctgcctgtcggcgggctcggcttcttcggctggccggcgatctcagggcaccgcgacggg
cactcgttcatcctggaattcggaaactggcaggccgaggaaatcgcttccggtgtcatt
ctgaaggctgaggaccctgtcgcagagatcggcctgcggatatgcatcgaggcgagcccc
gccgaggtgctgtcgatttcgacatcgttgaccaatcttggttccggcgattacaccctc
gaccgatgcatggcggcgagcttcctgatgcccgccggtgcggcggagctgaccaccttc
acaggcatgtggggtcgcgaattccagactcgccatacggcaattgccgacgggctctgg
atgcaggaaagccggcgcgggcgcacctcgcatgaccgcttccccttcgctttcctcgaa
tgcggtggcgagcggatgggcttccatctcggctggagcggcaatcacctgatggcgatc
gatacgcttgatgacgagcgccggctggtgcatctcggcgagctcttcgaaccaggcgaa
atacgtctggcaaccggcgaaacctatgctagcccgacagcctttgccgggcctgacagt
gaagctttccatgccttcgtgcgagagagcgtaattgcttggccgggcggcgagatgaag
ccccggccggtgacgctgaacacctgggaaggcaattactgcgatcaccgcatggactct
ctcaaggcccaggccgatgcggcggcggctgtcggcatcgagcgcttcgtcctcgatgac
ggttggttcggcaagcgcgacgacgataccaccagcctcggcgactggttcatcgacgag
cggaaatatcccgacgggcttaagccgctcgtcgaccatgtgacttcccttggcatggaa
ttcgggctctggttcgagcccgagaatgtaaatcccgaatccgagctctttcgcgcccat
cccgattgggctctgcaggtcgaagggcgtccgctgcttttgtcgagaaatcagctggtg
ctggatctgacgcggccggaggtcagcgactatctcttcagatgcatggaagccgtgctt
tcccagcatgcgatcgcctatatcaaatgggacatgaaccgcgacctgacccatgcaggc
ggcgcggatggccgtgctcggaccgcgcagcagacgcgggcggtctatgccctgatggat
aggatccggcaggcgtttccggccgtcgagatcgaaagctgcgcatcgggcggcgggcgt
atcgattatggtgttctccgacacacgcaccgcgtctggacctccgattgcaccgatgcc
ttcgaacggcttgagatacagcatggggcctcgcggttcgttccgccggaacttctcggc
gcgcacatcgccgcttcgccgaaccatcagaccggccgcaggctgacgctttccttccgg
gcgctcgtcgcgctcgcctatcatctgggtgtcgaactcaacccgctggccctcgatgcc
gaggagaagcaggagcttgaaggctggatcgcgcttcataagagcctgcgtccgctcctg
catgcgcctggcaagcaatttcgcctgccgccgctcgacggccgttacgtctggggtgct
gcggacgagagccgtatcgtggctttcgtcgcgcagggtccgcaaatggttggcgagcag
ccggcgccggttcgcctgccggtgagcggtgaaggtgctggcaagtggcgtgtgaaggcg
atccatcccgccgagcccgagttcatccggatatcggaaggacaacagcggcttctgaac
ggcgaactgaccttcagtctcgatacgctccggcatgtcggcttgccgctgccgatgctt
cggcccgaaagcgggcttcttcttgaattcgaaccagtgacgggagactaa

DBGET integrated database retrieval system