KEGG   Agrobacterium radiobacter: Arad_9475Help
Entry
Arad_9475         CDS       T00850                                 

Definition
(GenBank) phosphoglycerate mutase protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00010  Glycolysis / Gluconeogenesis
ara00260  Glycine, serine and threonine metabolism
ara00680  Methane metabolism
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
ara01200  Carbon metabolism
ara01230  Biosynthesis of amino acids
Module
ara_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_9475
  Energy metabolism
   00680 Methane metabolism
    Arad_9475
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arad_9475
Enzymes [BR:ara01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Arad_9475
Membrane trafficking [BR:ara04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Arad_9475
Exosome [BR:ara04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Arad_9475
  Exosomal proteins of melanoma cells
   Arad_9475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 KorB LCM
Motif
Other DBs
NCBI-ProteinID: ACM30510
UniProt: B9JKR8
Position
2:complement(2154999..2155745)
Genome map
AA seq 248 aa AA seqDB search
MRIFLVRHGESLGNISDQAYRQFGDHNVPLTQWGYRQALEAGRVIASYLEGLPATELQKQ
SIWYSPYLRTRQSKDALLEALPNTLVEDIREDYLLREQDFGLFTEIYDHAEQKRKFPEEF
EKWARLRNNSGKFYARPPDGESRADVAQRVRLFLQTVMHDAKNGRDNVIIVGHGVTNRAF
EMNFLHHSVDWFERSDNPGNADVTLIEGSLKDGYTSILLHKAVDRIAGQNELREAYGSEL
TVAPKAGQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctttctcgttcgacacggcgaatcccttggcaacatcagcgaccaggcctac
cggcagttcggtgatcacaatgttccgttgacgcagtggggctatcggcaggcgctggag
gcagggcgggtgatcgcgtcctatctcgagggactgccggctactgaattgcagaagcag
agcatctggtactcgccctatctcaggacgcgacagagcaaggatgccctgctggaagcc
ttgccgaacacattggtcgaggatatccgcgaggattacctgttgcgggaacaggatttc
ggcctctttaccgaaatctatgatcatgccgaacagaaacggaagtttcccgaagagttc
gaaaaatgggccagactgcgtaataatagcggaaagttctacgcacggccgccggacggc
gagagccgggccgatgtggcgcagcgggtccgtctgttccttcagaccgtcatgcacgac
gcgaagaacggcagggacaatgtcattatcgtcggtcacggcgttaccaacagggcgttc
gaaatgaatttcctgcaccattccgtcgactggttcgaacgctcggacaatcccggaaat
gccgatgtcaccttgatcgagggaagcctcaaggacggctatacgtcaatcctgctccac
aaggcggttgatcggatcgcggggcagaatgaattgcgcgaagcctatgggtctgagctg
acagtggcgccgaaggctgggcaatag

DBGET integrated database retrieval system