KEGG   Arachidicoccus sp. BS20: A9P82_00005Help
Entry
A9P82_00005       CDS       T04406                                 

Definition
(GenBank) chromosomal replication initiation protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
arb  Arachidicoccus sp. BS20
Pathway
arb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:arb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A9P82_00005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:arb03032]
    A9P82_00005
   03036 Chromosome and associated proteins [BR:arb03036]
    A9P82_00005
DNA replication proteins [BR:arb03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    A9P82_00005
Chromosome and associated proteins [BR:arb03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    A9P82_00005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 ATPase_2 AAA AFG1_ATPase AAA_14 Choline_kin_N DNA_pol3_a_NII RNA_helicase DUF2075 NACHT AAA_16 AAA_19 ATP-cone
Motif
Other DBs
NCBI-ProteinID: ANI87844
UniProt: A0A191TGK9
Position
1..1431
Genome map
AA seq 476 aa AA seqDB search
MSKTAESVWANCLDIIKDIVEWQHFKTWFEPIVPLQLKDNVLLIQVPSNFFYEYLEEHYV
SLLAKTLKRQLGRDARLEYRIMIDSGNTTDKGYMKVPSGEEKTHANTLVLPMKINDTNGL
NPFIVPGIKRMQIDPQLNSEDTFEKFVEGDCNRVARRAGKTVAEKPGNNSFNPLFIYGGS
GLGKTHLLHAIGNEVKKLHPNKVVLYVSSEKFINQFQHHSRNNQINDFINFYQLIDVLLI
DDVQFFNRAEKSQDAFFAIFNHLQQSGKQLVLTSDKAPKDLDGLQERLLSRFRWGLSADV
QVPDYETRIEIFEQKMREEGLEMPKEVVKYVAYNLTSNVRELRGALISLLAQSSLNKRDI
DIDLAKKVLRNIIKTNNKEVTIDAIQKMVCEYFDVPYNRLLEKTRKREVVQARQITMYLS
KTFTKNSLKTIGEHFGGRDHTTVIHSCQTVKDLMDTDSVFKENVMELTQKVQLASM
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacggcggaatctgtttgggcaaattgtctcgatataattaaggacattgtt
gaatggcagcattttaaaacctggtttgagccaattgtacccttgcagttaaaagacaac
gttttgctgatacaagtacccagtaattttttctacgaatacctggaagaacattatgtg
tcgctacttgcaaaaaccctgaaacgccagctgggtcgcgatgcgcggctcgaatatcgc
atcatgatagatagcggcaatacgaccgataaaggatacatgaaagttccatcgggcgaa
gaaaaaacgcatgccaacaccttggttttacctatgaaaatcaatgatacaaacgggctg
aatccattcattgtaccgggtataaaacgaatgcagattgacccgcaactcaattccgag
gatacttttgaaaaattcgtagaaggagattgtaaccgcgtggcaaggcgtgcaggaaag
accgttgccgaaaaaccgggcaacaattccttcaatccattgttcatttatggcggttcc
gggttggggaaaacgcacctgcttcatgcaataggcaatgaagtaaaaaagttgcatccg
aacaaagtagtcctgtatgtgagtagtgaaaaatttatcaatcagttccagcatcatagc
cgtaataatcaaataaatgattttattaatttctatcagttgatagacgtgttgctgatt
gatgatgttcaatttttcaatcgtgcagaaaaaagccaggacgcattttttgccatcttc
aaccatttgcagcaaagtggaaagcaattggtattaacatcggataaggctccaaaagat
ttggacggcttgcaggaaaggttactaagccgtttccgttggggattgagcgcagatgtt
caggtgccggattatgaaacacgtatcgaaatatttgaacaaaagatgcgcgaagaagga
ctggaaatgccgaaagaagtggtaaagtatgtggcatataatcttacaagcaatgtgcgt
gaactgcgcggagcgttgatttctttgttggcacagtcttctctcaataaaagagacata
gatattgatttagcaaaaaaggttttgcgcaatattattaaaaccaacaataaagaagtt
accattgatgccatccaaaaaatggtgtgtgaatatttcgatgttccttacaatcgcctt
ttagagaaaacgcgtaaacgagaagtggtacaggcaaggcaaattaccatgtatctttct
aaaacatttaccaagaactccttaaaaaccattggcgagcattttggcgggcgcgaccat
actaccgttattcatagttgccaaaccgtgaaagacttaatggataccgatagcgttttt
aaagaaaatgtaatggaacttacacaaaaagttcagcttgcttcgatgtaa

DBGET integrated database retrieval system