KEGG   Arachidicoccus sp. BS20: A9P82_02650Help
Entry
A9P82_02650       CDS       T04406                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
arb  Arachidicoccus sp. BS20
Pathway
arb00770  Pantothenate and CoA biosynthesis
arb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A9P82_02650
Enzymes [BR:arb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     A9P82_02650
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     A9P82_02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein KR NAD_binding_7 MitMem_reg
Motif
Other DBs
NCBI-ProteinID: ANI88299
UniProt: A0A191THW3
Position
complement(568180..569382)
Genome map
AA seq 400 aa AA seqDB search
MVVLQGKKILIGVTGSIAAYKIISLTRLLIKEGAEVKIVMTKAATKFVSPLVLSTLSKNK
VLINLFEKDVWANHVMLGRWADLMLIAPLSCNTLAKMANGQCDNLLLSVYLSATCKVMCA
PAMDEDMWHHAATRKNIEALTGYGNIVLGVDSGELASGLSGEGRMLEPENILLEIKNSFR
TNELTGETVLITSGSTHEAIDPVRFIANHSTGKMGTALAEAFYLRGADVIFISGPAQHFP
AYKNIEIIKVTSAEDMFIQAVQQFPNCSIAVLSAAVADYTPVETASQKIKKKEEQFTLSL
KKTKDILKELGSLKSNQLLVGFALETNNELDNARKKLADKNADLIVLNSMNEQGAGFGFD
TNKVTVLDKNGNQYESGLMSKQDVADYILEIVEEKLKQNA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atagttgtgttacaagggaaaaaaatattaattggtgttaccggaagcattgctgcgtac
aaaattatttcgctcacacgtttactgattaaagaaggagccgaagtaaaaattgtgatg
acgaaagctgcaacaaaatttgtctcgccgttggtgttaagcactttgtctaagaacaaa
gttttaatcaacttatttgaaaaggatgtttgggcaaatcatgtgatgcttggtcgttgg
gcagatttgatgctgattgctccgttaagctgcaatacattggcaaaaatggcaaacgga
caatgcgataatttgttgctttccgtttatctgtctgcaacctgcaaagtcatgtgtgcg
cccgcgatggacgaagatatgtggcatcatgctgcgacccgaaagaatattgaagcatta
accggttatgggaatattgtgttgggcgtggattccggcgaattggcaagcggactttcc
ggcgaaggaagaatgctcgaaccggaaaatattttgcttgaaataaaaaattctttcaga
acaaatgaattgacaggagagacggtattgattacttcgggaagcacacatgaagccatt
gacccggttcgttttattgccaatcattcaaccgggaaaatgggaacagccttggcggaa
gcattttatttacgcggcgcagatgtgatttttatcagcggaccggcgcaacattttccg
gcttataaaaatatagaaatcattaaagttacttctgccgaagatatgtttatacaggct
gttcagcaatttccaaattgctcaatcgctgtgctgtcggcggctgtagcagattataca
ccggtagaaacagcttcgcaaaaaataaaaaagaaagaagaacagttcactctttctttg
aaaaaaacaaaagatattctgaaggaattgggaagcctgaaatcaaatcagttgctggta
ggttttgccctggaaacaaataatgaattagataatgcacgaaaaaaactggcagataaa
aatgccgatttgattgtcctaaattctatgaatgaacaaggcgcaggctttggatttgat
acaaataaagtaactgtactggacaaaaacggcaatcaatacgaaagcggtttgatgagc
aagcaagatgttgcagattatattctcgaaattgtggaagaaaaattaaagcagaatgct
taa

DBGET integrated database retrieval system