KEGG   Arachidicoccus sp. BS20: A9P82_11290Help
Entry
A9P82_11290       CDS       T04406                                 

Definition
(GenBank) hypothetical protein
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
arb  Arachidicoccus sp. BS20
Pathway
arb00010  Glycolysis / Gluconeogenesis
arb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A9P82_11290
Enzymes [BR:arb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     A9P82_11290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EcoEI_R_C
Motif
Other DBs
NCBI-ProteinID: ANI89822
UniProt: A0A191TM93
Position
complement(2529469..2529843)
Genome map
AA seq 124 aa AA seqDB search
MQQIKNIIFDLGGVFLDISFAKSNEAFKALGLEDFDKHISQHHANDLFEKLETGKITPEA
FYDEFRAKTNLPLTNEQIENAWNAMLLHFSEDKMKWLEEVSKRYNTYLFSNTNKIHVDFF
TKKD
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaatcaaaaatattattttcgacctcggcggcgtattcttggatatcagcttt
gcaaaatcaaatgaagcatttaaagcattgggcttggaagattttgacaaacatatttcg
caacatcatgccaacgatttgtttgaaaaattagaaaccggaaaaataacgcctgaagcg
ttttatgatgaatttcgtgcgaaaacaaatttgcctttgaccaatgagcaaatcgaaaac
gcctggaacgcaatgttgctgcacttttcagaagacaaaatgaaatggttggaagaggtg
agcaagcgatacaacacgtatttattttccaacaccaataaaattcatgttgattttttt
acaaaaaaagattag

DBGET integrated database retrieval system