KEGG   Arachidicoccus sp. BS20: A9P82_11715Help
Entry
A9P82_11715       CDS       T04406                                 

Definition
(GenBank) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
arb  Arachidicoccus sp. BS20
Pathway
arb00511  Other glycan degradation
arb00520  Amino sugar and nucleotide sugar metabolism
arb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A9P82_11715
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A9P82_11715
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:arb03110]
    A9P82_11715
Enzymes [BR:arb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A9P82_11715
Chaperones and folding catalysts [BR:arb03110]
 Intramolecular chaperones
  Others
   A9P82_11715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Laminin_G_3 Sialidase
Motif
Other DBs
NCBI-ProteinID: ANI90757
UniProt: A0A191TPV6
Position
complement(2650593..2652629)
Genome map
AA seq 678 aa AA seqDB search
MSKKINVSGKYTDEGTNPKPFIIPSLQEWYGDKGEYIFSSAIRIIADASSKETMQAATIL
QKDIKEVTGLHLQIADAKAQKGDICLSLKEKDRSIGSEGYYFSVSDKIKISATAYQGLFW
GTRTLLQLLSRSKNIPQGTARDYPQFKVRGFVLDDGRKFFSLTFLRDYVKLLSYYKMNDF
QIHLNDNGFNSFFGYNWDSTYSAFRLENESFPGLTAKDGSYTKQEFRDLQKLADEYGVNI
VPEIDVPAHSLAFTKAVPAIGSKEYGRDHLDLHNPLTDSVIQQVFREYLEGPHPVFTGPA
VNIGTDEYNKKDAEAYRAFTDRMIKFVQSYGKEVRMWGGLTWSPGKTPVRSKGVTIDIWS
KDFSEPREMKRLGFRQISTPDAWLYIVPAAGYYYDYLDLKKLYNEWSPLVSVGNVHFKAG
DPTIEGAAFAEWNDVVGNGVSEKDVNDRVFPAVQVLSQKMWNGNKPKMAFDAFKDSSLLV
GEGPGLNIRGRLPDSTLYFSFDKAGKQIKTVNASFVKGLKGHALLFDGKNSYAELLVTEA
GYNYTVSFFINPSGNNNDNASIFSSPDAVLKLKQGNSGLMGFSRDGYNFSFNYAVPANVW
THIVIAGTNKGTDLYVNGKLQDHLYDHFIQFHDKDSTKRRLVETLFFPLQQVGGFNGKID
ELKIWNRVLSETEIRNMN
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atttcaaaaaaaataaacgtttccggtaaatatacagatgaaggaaccaatccaaaacct
ttcataattccctcgttgcaggaatggtacggcgacaaaggagagtatattttctcatcg
gccataaggattattgccgatgcatcttccaaagaaacgatgcaagccgccacaatctta
caaaaagatattaaagaagtaacagggttacatctgcaaatcgcagacgccaaagcgcag
aagggcgatatctgtttatccctgaaagaaaaagaccgttcaattggcagcgaaggttat
tatttttctgtaagcgataaaattaaaataagcgcaacggcatatcaaggactgttttgg
ggaacaagaacgctgttgcagttattgtcaaggtcaaaaaatattcctcaaggaactgcg
agggattatccccaattcaaagtaagagggtttgtcctggacgacgggagaaaatttttc
agtttaacgtttctgagggattatgtaaagctcctgtcgtattataagatgaacgatttc
cagattcatttgaacgataacggctttaattcttttttcggttacaactgggacagcacc
tattcggcgttcagattggaaaatgaaagcttcccgggtttgaccgccaaagacggctct
tacacgaagcaagagttccgtgatttacaaaaactggccgatgagtacggtgtgaatatt
gttcccgaaatagatgttcctgcgcattcgctggcatttaccaaagcggttcctgctatc
ggaagcaaggaatacgggcgcgatcatttggacttgcacaatccgcttaccgattccgtt
atccaacaagtgttcagggaatatctggaaggtcctcatcctgtgtttaccggccctgca
gtaaatatagggacagacgaatataacaaaaaagatgcggaggcttatcgggcttttaca
gatcgtatgataaaatttgtccagtcttacggaaaagaagtgagaatgtggggtggttta
acctggtcgccgggaaagacgcctgtacgaagcaagggcgttacaatagatatttggtct
aaggatttctctgaaccgcgcgaaatgaaaagactgggtttcagacaaatcagtacaccg
gatgcctggttgtatatcgtgccggctgccggctattattacgattatctcgacctgaaa
aagctttataatgaatggtcgcctctggtttctgtgggtaacgttcatttcaaagcaggc
gatcctaccattgaaggggctgcttttgccgagtggaacgatgtcgtgggcaacggtgta
agcgaaaaagacgtaaacgaccgtgtttttcctgccgtgcaggtattgtcgcagaaaatg
tggaacggcaacaaacccaaaatggcatttgatgcatttaaagactcaagcttgttggtt
ggggaaggccccggactcaatattcgcggaaggttgccggatagcactttgtattttagt
tttgacaaagccggcaaacaaataaaaacggtaaatgcttcttttgtaaaaggcttgaaa
gggcacgcacttttattcgacgggaaaaatagttatgccgagcttcttgttacagaagcc
ggttataattacaccgtttcttttttcatcaatccttccggtaataataatgacaatgct
tctatattttcatcgccggatgcggtgcttaaacttaaacaaggcaactccggattaatg
ggcttttcaagagacggctataattttagctttaattatgccgtaccggcaaatgtatgg
acacacatagttatagccggaacaaataagggtacggatttgtatgtaaacggtaaattg
caagatcatctttacgatcattttattcaattccatgataaggacagcaccaaaagaaga
ttggtcgaaactttatttttcccgcttcagcaagtaggtggttttaatggcaaaatagat
gaactgaagatttggaaccgtgttctctctgaaactgaaatcagaaatatgaactga

DBGET integrated database retrieval system