KEGG   Arcobacter sp. L: ABLL_0117Help
Entry
ABLL_0117         CDS       T01834                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
arc  Arcobacter sp. L
Pathway
arc00071  Fatty acid degradation
arc00280  Valine, leucine and isoleucine degradation
arc00310  Lysine degradation
arc00362  Benzoate degradation
arc00380  Tryptophan metabolism
arc00620  Pyruvate metabolism
arc00630  Glyoxylate and dicarboxylate metabolism
arc00640  Propanoate metabolism
arc00650  Butanoate metabolism
arc00900  Terpenoid backbone biosynthesis
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01120  Microbial metabolism in diverse environments
arc01130  Biosynthesis of antibiotics
arc01200  Carbon metabolism
arc01212  Fatty acid metabolism
arc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:arc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABLL_0117
   00630 Glyoxylate and dicarboxylate metabolism
    ABLL_0117
   00640 Propanoate metabolism
    ABLL_0117
   00650 Butanoate metabolism
    ABLL_0117
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABLL_0117
   00072 Synthesis and degradation of ketone bodies
    ABLL_0117
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABLL_0117
   00310 Lysine degradation
    ABLL_0117
   00380 Tryptophan metabolism
    ABLL_0117
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABLL_0117
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABLL_0117
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABLL_0117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:arc04147]
    ABLL_0117
Enzymes [BR:arc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABLL_0117
Exosome [BR:arc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABLL_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt 7TMR-HDED
Motif
Other DBs
NCBI-ProteinID: BAK71992
UniProt: G2HRM6
Position
102489..103682
Genome map
AA seq 397 aa AA seqDB search
MKVYIVEAKRSAIGSFLGSLKDVTPGDLAGQVIKDLTKNIDKNIVDEVIVGNILSAGHLQ
GIGRQAAIFAGLPKSTVAYSLNMLCGSGMKAVMNAIAQIKSGECDVIVAGGVESMSGAPF
LVSSKARTSLGLGDGKLVDSISDALTDAFEGYHMGITAENVAEKFNITRQMQDEYALESQ
KKAIKADDAGKFKDEITPITVKTKKGEIIFDKDEYINRNTSLEKLDNLRAVFKKDGTVTA
GNASGINDGASFTLIASEDAVKKYNLKPLVEIVDIAQVGIEPSVMGLSPAYAIEKLLNKT
GVDISDIDVIEINEAFAAQILGVFELLKEKVNLTDEILNEKMNVNGSGIALGHPVGASAN
RIIVSLIYEMLKQNSTYGLASLCIGGGLGTAILLKKV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtatatatagttgaagcaaaaagaagtgcaataggaagttttttaggtagttta
aaagatgtgacacctggtgatttagcaggacaagttataaaagatttaacaaaaaatatt
gataaaaatattgttgatgaagttattgttggaaatatattaagtgcaggtcatttacaa
ggaatcggaagacaagcagctatttttgcaggcttaccaaaatcaacagttgcatattct
ttaaatatgttatgtggatctggaatgaaagcagttatgaatgccattgctcaaataaaa
tcaggtgaatgtgatgttatagttgcaggtggtgttgaaagtatgtctggtgcaccattt
ttagtttcttcaaaagcaagaacaagtttaggattaggtgatgggaaattggttgattct
ataagtgatgcattaacagatgcttttgaaggttatcatatgggaataacagcagagaat
gttgctgaaaaatttaatataactagacaaatgcaagatgaatatgcattagaatctcaa
aaaaaagcaataaaagcagatgatgctggaaagtttaaggatgaaataactccaatcact
gtaaaaacaaaaaaaggtgagattatttttgataaagatgaatatattaatagaaataca
tctttagagaaactagataatctaagagctgtttttaaaaaagatggaacagttacagca
ggtaatgcatctggaataaatgatggtgcaagtttcacactaatagcgtcagaagatgca
gtaaaaaaatataatttaaaacccttagttgaaattgttgatattgcccaagttggtatt
gaaccttctgttatgggattaagcccagcttatgctattgaaaagttattaaataaaaca
ggtgttgatataagcgatattgatgtaattgaaataaatgaagcatttgctgcacaaatt
ttaggtgtatttgaattattaaaagaaaaagtaaatttaacagatgaaatattaaatgaa
aaaatgaacgtaaatggaagtggaattgccttaggtcatcctgttggagctagtgcaaat
agaattattgtttcactaatttatgagatgttaaaacaaaattcaacttatggtttagct
tcattatgtatcggtgggggactaggtacggctattttacttaaaaaagtataa

DBGET integrated database retrieval system