KEGG   Arcobacter sp. L: ABLL_1096Help
Entry
ABLL_1096         CDS       T01834                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
arc  Arcobacter sp. L
Pathway
arc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01130  Biosynthesis of antibiotics
arc01230  Biosynthesis of amino acids
Module
arc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABLL_1096
Enzymes [BR:arc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ABLL_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: BAK72971
UniProt: G2HV18
Position
1122087..1122878
Genome map
AA seq 263 aa AA seqDB search
MILDEIIEKTKQDLEIRKKEISLDLLGRTLSSNPYTPRDVKPFLTSTKDEPIRIIAEVKK
ASPSKGIIKEDFDPLVIAQAYSNSGANAISVLTEPHYFKGNLEYLTQIRRYVPTPLLRKD
FIVDKYQIVEALVYGADFILLIAKALETKELKELYDYAIHLGLEVLVEIHDKEDLTKAIK
CGATIIGINHRNLDTFEMDMSLCDKLIPLIPNGKIIVAESGVSDVEVIKRLNSIGADAFL
IGEHFMRVPSIEEELKKFKNALN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgattttagatgagattatagaaaaaacaaaacaagatttagaaattagaaaaaaagag
ataagtttagatttattaggaagaacattatcttcaaatccatatactccaagagatgta
aaaccatttttaacttcaacaaaagatgaaccaattaggataattgccgaagttaaaaaa
gcaagtccaagtaaagggattataaaagaggattttgatcctttagttattgcccaagct
tatagtaatagtggagcaaatgcaatttcagttttaactgaacctcattattttaaaggt
aatttagagtatttaactcaaattagaagatatgtaccaactccacttttaagaaaagat
tttattgttgataaatatcaaattgttgaagctttagtttatggagcagattttatttta
ttaatcgctaaagctttagaaacaaaagagttaaaagagctttatgattatgcaattcac
ttaggacttgaagttttagttgaaattcatgataaagaagatttaacaaaagctatcaaa
tgtggagctacaataattggaataaatcatagaaatcttgatacttttgaaatggatatg
agtttatgcgataaattaattccattaattccaaatggaaaaataattgttgcagaatct
ggagtttcagatgtagaagttatcaaaagattgaactctattggagctgatgcattttta
attggtgaacattttatgagagttccatcaattgaagaagaattaaaaaaattcaaaaac
gctttaaattaa

DBGET integrated database retrieval system