KEGG   Arcobacter sp. L: ABLL_1549Help
Entry
ABLL_1549         CDS       T01834                                 

Definition
(GenBank) methionyl-tRNA synthase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
arc  Arcobacter sp. L
Pathway
arc00450  Selenocompound metabolism
arc00970  Aminoacyl-tRNA biosynthesis
arc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ABLL_1549
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ABLL_1549
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arc01007]
    ABLL_1549
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:arc03016]
    ABLL_1549
Enzymes [BR:arc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ABLL_1549
Amino acid related enzymes [BR:arc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ABLL_1549
Transfer RNA biogenesis [BR:arc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ABLL_1549
 Prokaryotic type
   Other AARSs
    ABLL_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f NOB1_Zn_bind zf-NADH-PPase zinc-ribbons_6 Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: BAK73424
UniProt: G2HWC1
Position
1569768..1571726
Genome map
AA seq 652 aa AA seqDB search
MQESCKNVYITTPIYYVNDVAHIGHAYTTIIADMLARYSRLIGHETFFLTGTDEHGQKIA
QSAEARGKTPKEYADEISGKFKTLWDDFDITYDKFIRTTDLEHKAGVQKAFETMFNKGDI
YKGEYEGFYCVSCETFFTEKQLVDEQFCPDCGRPTSIVKEESYFFKLSKYEEKLLKWYEE
NEDCILPRSKKNEIVNFVKGGLKDLSISRTSFDWGVKLPESMNEPKHVMYVWLDALMNYI
TALGYGTDNKNMDFWPANVQLVGKDILRFHAIYWPAFLMSLELPLPKHIAAHGWWTRDGE
KMSKSKGNVVNPKEVADAYGLDAFRYFMLREVPFGQDGDFSQKALIDRINSDLGNDLGNL
LNRISGMSGKYFDYKVSSIDVIKFHAKELEEVHSILGSVENYLFNMQINKYLEEIWKVLT
IANKAINDYEPWNLMKDGKTAEAMALVALITNIMAKVALLLDSVMPEKIKLIAQSLGMNI
NTETFNKLIKNQELLADTVITKVDQLFPRIEEILLEQPPVSDETKAECEIKKVAKVEEKK
EEDDNLITIDQFFQTTLKIGTIVEAVEVPKSAKLLKLQVDLGEGRNRQILAGIKEYYKAE
ELVGTQACVVANLKPAKLMGMISEGMLMAAKDENGLSLLRPEAPKKSGTKIS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatcttgtaaaaatgtttatataacaacaccaatttattatgtaaatgatgta
gcgcacattggtcatgcatatacgacaattatcgctgatatgttagctagatattcaaga
cttataggtcatgagacattttttctaacaggaactgatgaacatggtcaaaaaatagca
caaagtgcagaagctagaggaaaaactccaaaagagtatgcagatgaaatatctggtaaa
tttaaaacattatgggatgattttgatataacatatgataaatttattagaacaacagat
cttgaacataaagctggcgttcaaaaagcatttgaaacaatgtttaataaaggggatatt
tacaaaggtgaatatgaaggtttttactgtgtatcttgtgagacattttttactgaaaaa
caattagtagatgagcaattctgtcctgattgtggaagaccaacttcaatagtaaaagaa
gagagttacttctttaaattatcaaaatatgaagaaaaacttcttaaatggtatgaagaa
aatgaagattgtattttacctagaagcaaaaaaaatgaaatagtaaactttgtaaaaggt
ggattaaaagatttatcaatttcaagaacttcttttgattggggagtaaaactaccagaa
tcaatgaatgaaccaaaacatgttatgtatgtttggttagatgcattaatgaactatatc
acagctttaggatatggaactgacaataaaaatatggatttctggcctgcaaatgttcaa
cttgtaggaaaagatattttaagattccatgctatttattggccagcatttttaatgtct
ttagaattacctcttccaaaacatattgcagctcatggttggtggacaagagatggtgaa
aaaatgtctaaatcaaaaggtaatgtagtaaatcctaaagaagtagctgatgcttatgga
cttgatgcatttagatattttatgttaagagaagttccatttggtcaagatggagatttt
tctcaaaaagcactaattgatagaattaactctgatttaggaaatgatttaggaaactta
ttaaatagaatttctggaatgagtggaaaatattttgattataaagttagttcaattgat
gttataaaattccatgcaaaagaacttgaagaagttcattctattttaggaagtgttgaa
aactatctttttaatatgcaaataaacaaatatcttgaagaaatttggaaagttttaaca
attgcaaataaagcaatcaatgattatgaaccttggaatttaatgaaagatggaaaaact
gctgaagctatggctttagttgcactaatcacaaacattatggctaaagttgccctactt
ttagattctgtaatgcctgaaaaaataaaattaattgcacaatctttaggtatgaatatt
aacactgaaacttttaataaactaataaaaaatcaagaattattagctgatacagttata
acaaaagttgatcaactattcccaagaattgaagaaattcttttagaacaacctcctgta
tcagatgaaacaaaagctgaatgtgaaataaaaaaagttgcaaaagttgaagaaaaaaaa
gaagaagatgataatttaatcactatagaccaattttttcaaactactttaaaaattgga
acaattgttgaggcagttgaagttccaaaatctgcaaaacttctaaaattacaagtagat
ttaggagaaggaagaaatagacaaattcttgcaggtattaaagaatattataaagctgaa
gaattagtaggaactcaagcatgtgttgttgcaaacttaaaacctgcaaaacttatggga
atgattagtgaaggtatgttaatggctgctaaagatgaaaatggtttatcattattaaga
ccagaagctcctaaaaaatctggaacaaaaattagctag

DBGET integrated database retrieval system