KEGG   Arcobacter sp. L: ABLL_1567Help
Entry
ABLL_1567         CDS       T01834                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
arc  Arcobacter sp. L
Pathway
arc00860  Porphyrin and chlorophyll metabolism
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABLL_1567
Enzymes [BR:arc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ABLL_1567
Exosome [BR:arc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABLL_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMPdecase
Motif
Other DBs
NCBI-ProteinID: BAK73442
UniProt: G2HWD9
Position
1587105..1588079
Genome map
AA seq 324 aa AA seqDB search
MFKRFRRLRINETLRNLVQETVLTPDDFIYPLFVREGQNIKTEVASMPGVYQMSIDEILK
ECEYLVSINLKSIILFGIPDTKDSVGSECLCGESIIARTIKAIKAKFPQMFIVTDLCFCE
YTDHGHCGILDPKTGSVDNDKTLEISAQQAVVHAKAGADMIAPSGMMDGIITTLRNALDE
NGFKNLPIMAYSTKFASGYYGPFRDVAESTPSFGDRRTYQMNPANRLEAIEESLEDEKEG
ADILMVKPALAFLDIVRDIRNQTNLPLCVYNVSGEYAMLKHAGIAGLIDYERVMMETMIA
FKRAGANIIISYHAKEVCEILRNN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacgatttagaagattaagaattaatgaaacactaagaaatttagtacaagaa
acagttttaacacctgatgatttcatctatccattatttgtaagagaaggtcaaaatata
aaaactgaagttgcatcaatgcctggtgtttatcaaatgagtattgatgaaattttaaaa
gagtgtgagtatttagtaagtataaatttaaaatcaattattctttttggtattccagat
actaaagattcagttggaagtgaatgtttatgtggggagagtataattgcaagaactatt
aaagcaatcaaagcaaaattccctcaaatgtttatcgtaactgatttatgtttttgtgaa
tatacagaccatggacattgtggtattttagacccaaaaactggaagtgttgataatgat
aaaacattagaaatctctgctcaacaagcagtagttcacgctaaagctggagctgatatg
attgcaccatctggaatgatggatggaattattacaactttaagaaatgcacttgatgaa
aatggatttaaaaatcttccaatcatggcatattcaacaaaatttgcaagtggatattat
ggaccatttagagatgttgctgaatcaactccaagttttggtgatagaagaacttatcaa
atgaatcctgcaaatagacttgaagcaattgaagaatcacttgaagatgaaaaagaaggt
gcagatatacttatggtaaaaccagcacttgcatttttagatattgttagagacataaga
aaccaaactaatcttcctttatgtgtttataatgtaagtggtgaatatgcaatgcttaaa
catgctggaattgctggattaattgactatgaaagagttatgatggaaacaatgattgca
tttaaaagagcgggtgcaaatatcatcatctcttaccatgcaaaagaggtttgcgaaatc
ttaagaaacaactaa

DBGET integrated database retrieval system