KEGG   Arcobacter sp. L: ABLL_1921Help
Entry
ABLL_1921         CDS       T01834                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
arc  Arcobacter sp. L
Pathway
arc00071  Fatty acid degradation
arc00280  Valine, leucine and isoleucine degradation
arc00310  Lysine degradation
arc00362  Benzoate degradation
arc00380  Tryptophan metabolism
arc00620  Pyruvate metabolism
arc00630  Glyoxylate and dicarboxylate metabolism
arc00640  Propanoate metabolism
arc00650  Butanoate metabolism
arc00900  Terpenoid backbone biosynthesis
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01120  Microbial metabolism in diverse environments
arc01130  Biosynthesis of antibiotics
arc01200  Carbon metabolism
arc01212  Fatty acid metabolism
arc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABLL_1921
   00630 Glyoxylate and dicarboxylate metabolism
    ABLL_1921
   00640 Propanoate metabolism
    ABLL_1921
   00650 Butanoate metabolism
    ABLL_1921
  Lipid metabolism
   00071 Fatty acid degradation
    ABLL_1921
   00072 Synthesis and degradation of ketone bodies
    ABLL_1921
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABLL_1921
   00310 Lysine degradation
    ABLL_1921
   00380 Tryptophan metabolism
    ABLL_1921
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABLL_1921
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABLL_1921
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABLL_1921
Enzymes [BR:arc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABLL_1921
Exosome [BR:arc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABLL_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt CDK2AP
Motif
Other DBs
NCBI-ProteinID: BAK73796
UniProt: G2HXE3
Position
1958763..1960037
Genome map
AA seq 424 aa AA seqDB search
MKERIAIIDGLRSPIAKANGKLNDVSADILGSIITKELVLRNNLEYEQFDEVIMGNVANP
ANATNIARVMASRAGFPSQTPAYTVHRNCASGMQAISSAIEKIHSNQGDLYLVGGIESMS
NLPLYYSNELKNLITKFTYSKSFIEKIQLLSSFRPSFLKPTIGLLTGLTDPISGKIMGLT
AENLANEFKISRDAQDEYALKSHQKAQKAIETGIFKDEIHPIMTSNASITQDDGVRFNQT
IEALNKLKPIFDRLSGTVTAGNSSQVSDGACSLIVCSESKAKELNLEPLGFIKDYAYAGL
DANRMGLGPIYATKKLFDKTNITLKDIDLIEMNEAFAAQMIANQKAFASNDFCKKTFNSN
ALGEIDESILNVNGGAIALGHPVGMSGARIVLTALKELRRRKDKLALATLCIGGGQGASF
LLEI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagagaattgccataattgatggattaagaagtccaatagctaaagcaaatggt
aagttaaatgatgtaagtgctgatattttaggaagtattattacaaaagagttagttctt
agaaataatttagaatatgaacaatttgatgaagtaattatgggaaatgttgcaaatcct
gcaaatgctacaaatatcgcaagagttatggctagccgtgctggttttccttcacaaact
cctgcttatacagttcatagaaattgtgcttcaggaatgcaagcaatatcaagtgctatt
gaaaaaattcattcaaatcaaggggatttataccttgttggaggaattgaatctatgagt
aatcttcctttatattatagtaatgagttaaaaaatctaataacaaaatttacatattca
aaatcatttattgaaaaaatccaacttttaagctcttttagaccaagttttttaaaacct
actattggtttactaactggtcttactgacccaatttcaggaaaaatcatgggattaaca
gctgaaaatctagcaaatgagtttaaaataagcagagatgctcaagatgaatatgcttta
aaatctcatcaaaaagctcaaaaagcaatagaaactggaatttttaaagatgaaattcat
ccaattatgacaagtaatgcttcaattacacaagatgatggagtaagatttaatcaaact
attgaagccttaaataaactaaaacctatttttgatagattaagtggaactgtaacagct
ggtaattcttcgcaagtttcagatggagcttgtagtttgatagtttgtagtgaatcaaaa
gcaaaagaattaaatcttgaaccacttggatttataaaagattatgcttatgcaggactt
gatgcaaatagaatgggattaggtccaatctatgcaacaaaaaaactttttgataaaact
aatattactttaaaagatatagatttaattgagatgaatgaagcttttgctgctcaaatg
atagcaaatcaaaaagcttttgcttcaaatgatttttgtaaaaaaacttttaattcaaat
gctcttggtgaaattgacgaatcaattttaaatgtaaatggtggagcaattgcccttggt
catccagttggaatgagtggagctagaattgttttaacagcccttaaagaattaagaaga
agaaaagataaattggcacttgcaacactttgtattggtggtggacaaggtgcatctttc
ttattggagatataa

DBGET integrated database retrieval system