KEGG   Arcobacter sp. L: ABLL_2023Help
Entry
ABLL_2023         CDS       T01834                                 

Definition
(GenBank) phosphate transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
arc  Arcobacter sp. L
Brite
KEGG Orthology (KO) [BR:arc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ABLL_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TMF_TATA_bd
Motif
Other DBs
NCBI-ProteinID: BAK73898
UniProt: G2HXP5
Position
2071417..2073003
Genome map
AA seq 528 aa AA seqDB search
METKILNSIEKIEKKTLPDFAKLSLALLFIVVVFLWSYASHGNLPNNTFLIIGAVFGAYM
AMNIGANDVANNVGPAVGSKALTLTGAIFIAAIFESLGAFIAGGDVVKTIKDGIINPDLI
KNPEIFIWAMTAALLSAALWLNFATSIGAPVSTTHSIVGGVMGSGIAAAGFAIVSWDTVG
KIVASWVVSPLLGGIIAAGFLYFIKKQIIYKENMIEASKKFVPILISVMTWTFSTYIILK
GLKHLVDLNFFVASVIAFFITVGVYLLVKPLIAKSSNKLANTRASVNSLFNIPLVFAAAL
LSFAHGANDVANAIGPLAAINDAIVNVEIASKVSIPFWVMAVGAFGIVIGLTLYGPKLIK
TVGSEITELDQMRAYSIAMAAAFTVIVASQLGLPVSSTHIAVGGVFGVGFLREFLDNNEK
RFLQETRKRFKRHKRELDLMQEELNRLEIIKDKSKTHYVKIVELYKKIDDKENLVKQERK
DVKDAKSTKYVKRDAIKKIIAAWIITVPAAAILSVAIFFMIKGFMASI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtggaaactaaaatattaaactctattgaaaaaattgagaaaaagaccctgccagatttt
gcgaagttgtcgctagcattgctatttatagtagtagtgtttttgtggtcgtatgcctca
catgggaacttgccaaataatacgtttctaataataggagcagtgtttggtgcttatatg
gcaatgaatattggagcgaatgatgtagcaaataatgtaggaccagcagttggctctaaa
gctttgactcttacaggtgctatttttatcgctgctatctttgaatcacttggagctttc
atagctggtggggatgtagtaaaaacaattaaagatggtattattaatcctgatttgata
aaaaatcctgaaatatttatctgggcaatgacagctgccttgctttctgctgcactttgg
ttgaattttgcaacttctattggagcacctgtttcgacaacacattctattgtaggtggt
gtaatgggttcaggaatagcagcagctggttttgcaatagtttcttgggatactgttggt
aaaattgtagcctcttgggttgtttctcctttgcttggtggaataatagcagcaggattt
ctttactttataaaaaaacaaataatctataaagaaaatatgatagaagcctcaaaaaaa
tttgttccaattttgatttcagtaatgacttggacttttagtacttatatcatcttgaaa
ggcttgaaacaccttgttgatttgaatttctttgtagcttctgtaattgcattttttata
actgttggtgtttatcttcttgttaaaccattaatagctaaatcttcaaataaattggca
aatacaagagcttctgtaaatagcttgtttaatattcctttggtgtttgcagcagccttg
ctttcttttgcacatggagcaaatgatgtggcaaatgcaattggaccacttgcagcaata
aatgatgcaatagtaaatgtagaaatagcatcaaaagtaagtattcctttttgggtaatg
gcagtaggagcatttggtatagtaataggattgactctatatggaccaaaactgataaaa
acagtaggctcagagataacagaacttgatcaaatgagagcatactcaatagcaatggca
gcagcattcacagtaatagtagcaagccaattgggacttccagtgtcttcaacacatata
gcagtaggtggagtgtttggagtaggatttttaagagagtttttggataataatgagaag
agatttttgcaagagacaagaaaaaggtttaaaagacataaacgagaattggacttgatg
caagaagagttgaatagattagagataataaaagataaatcaaaaacacattatgtaaaa
atagtagagttgtataaaaagatagatgataaagagaacttggtaaaacaagagagaaaa
gatgtaaaagatgcaaaaagtacaaaatatgtaaaaagggatgctattaagaagataata
gcagcttggattataactgtacctgctgcggctattctttctgtggctatcttttttatg
attaaaggatttatggcttctatttaa

DBGET integrated database retrieval system