KEGG   Arcobacter sp. L: ABLL_2183Help
Entry
ABLL_2183         CDS       T01834                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
arc  Arcobacter sp. L
Brite
KEGG Orthology (KO) [BR:arc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:arc02044]
    ABLL_2183
Secretion system [BR:arc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   ABLL_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: BAK74058
UniProt: G2HY55
Position
complement(2236444..2237712)
Genome map
AA seq 422 aa AA seqDB search
MQLLFEIINENNRTNNIFRLENKDAIIGRSIQSDWQLYDEMCHISGKHILIEYKDGLYFL
TDISTNGTFLKNPYKKLPKDIPIKINTNDIYIIGNYEIKVKFLEQEASLKSLSSFDYLLN
NEKSMNNQMIIPDDDFLLEDSSVMNNSFIKEEKKINTNNFFDIYENNENKIFDILNSSSS
LEEENYEDNIPSFDVLNEHLDTSSYKIETMEEGIECEIEDEIIEIKNSEVNNEILSQLEQ
RLGIKISKLSKVEQKKVIDEIVDIVLNTITGLRNSLAIKDKFLSDMNLEKLISNNDDLNP
IKKGKNESLMTLLNTSNEVITISQAVKNSFMDLDNHNLVVNSNINFTISNTIEEFSPENV
LNKLDKNSKYKSYLPKKFQIWDLYIKDYENLKSENSEIFNKLKNNYSREYIDLLNSLKTS
KI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcaattattatttgaaataattaatgaaaataatagaacaaataatatttttagatta
gaaaataaagatgcaattattggtcgttctattcaatcagattggcagttgtatgatgaa
atgtgtcatatctcaggcaaacatattttaattgaatataaagatggattatatttttta
actgatattagtacaaatggaacatttcttaaaaatccatataaaaaattgcctaaagat
attccaataaaaataaatactaatgatatttatataattggtaattatgaaataaaagtt
aagtttttagaacaagaagcctctttaaaaagtctatcttcttttgattatcttcttaat
aatgaaaaaagtatgaataatcaaatgattattcctgatgatgattttttacttgaagat
agttcagttatgaataatagttttataaaagaagaaaaaaaaataaatacaaataatttc
tttgatatttatgaaaacaatgaaaataaaatatttgatatattaaattctagtagttct
ttagaagaagaaaattatgaagataatattccaagttttgatgtattaaatgaacattta
gatacttcatcatataaaatagagacaatggaagaaggaatagaatgtgaaattgaagat
gaaattattgaaataaaaaatagtgaagtcaataatgaaattctttctcaactagaacaa
agattaggtataaaaataagtaaattatcaaaagtagaacaaaaaaaagtaatagatgaa
atagttgatattgttttaaatacaattactggattaagaaattctttggcaattaaagat
aaatttttgtcagatatgaatttagagaaattaatttcaaataatgatgatttaaaccca
ataaaaaaaggtaaaaatgaatctttaatgactttattaaatacatcaaatgaagttatt
actatttctcaagcagtaaaaaattctttcatggacttagataatcataatttagttgta
aattctaatataaattttactatttctaatacaatagaagaattttctcctgaaaatgtt
cttaataaattagataaaaattctaaatataaatcatatctaccaaaaaaattccaaata
tgggatttatatatcaaagactatgaaaatctaaaaagtgaaaatagtgaaattttcaat
aaacttaaaaataactattcaagagaatatattgatttattgaatagtttaaaaacatca
aaaatatag

DBGET integrated database retrieval system