KEGG   Arcobacter sp. L: ABLL_2186Help
Entry
ABLL_2186         CDS       T01834                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
arc  Arcobacter sp. L
Brite
KEGG Orthology (KO) [BR:arc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:arc02044]
    ABLL_2186
Secretion system [BR:arc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABLL_2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: BAK74061
UniProt: G2HY58
Position
complement(2240353..2241345)
Genome map
AA seq 330 aa AA seqDB search
MTLEEINKRINKDITKMDLPQSIRAIIVYLKMYHPNEIEENLYKKIIFKSNHSLSFPKSE
VNYVNFIDLQNGVEVEVTLNFLSIFGSSSPLPTHYSEMVLSSFDSDKILYDFLNLFNHHL
QKFIYPIWEKHRYYVQYKQDLSDRFSKYILSFLGLYTNTENSLLNFSKLIPFLGILMMKN
KSSSTLETILKHYLNHENIEIIQCIKEKYIIPSFQNSLLGFNNSSLGQDFLIGEYVISRN
NKFRIVLKDVDYEDLLKYSILGEKSKELDELIFFCIRDLFSYELVLNIKKENKKKFILSN
NNNYLGINLWLGNSSVDEDILVIKKEKYEN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgactttagaagaaataaataaaagaataaataaagatataactaagatggatttacct
caatcaatacgtgcaataattgtatatttaaagatgtatcatcctaatgaaattgaagaa
aatttatataaaaaaattatatttaaatcaaatcatagtttaagttttccaaaatcagaa
gttaattatgtaaattttattgatttacaaaacggtgtggaagtagaagttacgttaaat
tttttgagtatttttggctcatcatcaccacttcctactcattatagtgaaatggtttta
tcaagttttgatagtgataaaattttatatgattttttaaatttatttaatcatcatcta
caaaaatttatttatccaatatgggaaaaacatagatattatgttcaatataaacaagat
ttaagtgacagattttctaaatatattttgtcttttttaggtttatatacaaatacagaa
aatagtttattgaatttttcaaaacttattccttttcttggtatattgatgatgaaaaat
aaatcatcttcaaccttagaaacaattttaaaacattatttaaatcatgaaaatatagag
attattcaatgtataaaagaaaagtatattataccttcttttcaaaatagtttacttggt
tttaataattcatctcttggtcaagattttttaattggagagtatgtaataagtagaaat
aacaaatttagaatagtattaaaagatgttgattatgaagacttacttaaatatagtatt
ttaggtgaaaaaagtaaagaacttgatgaacttatatttttttgtatacgagatttattt
agctatgaattagttttaaatataaaaaaagagaataaaaaaaaatttattttatcgaat
aataacaattatctaggaataaacctttggttagggaactcaagtgtcgatgaagatata
ttagtaataaaaaaggagaaatatgaaaattga

DBGET integrated database retrieval system