KEGG   Arcobacter sp. L: ABLL_2189Help
Entry
ABLL_2189         CDS       T01834                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
arc  Arcobacter sp. L
Brite
KEGG Orthology (KO) [BR:arc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:arc02044]
    ABLL_2189
Secretion system [BR:arc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABLL_2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: BAK74064
UniProt: G2HY61
Position
complement(2243538..2245013)
Genome map
AA seq 491 aa AA seqDB search
MLTKEQIENSQIRENNSLLDDIVSHTKLNKNDDSYNVVKNGVEALIQELINTDDSEERVN
KSVIDKMIAELDRKISTQMDEIIHNKNFQELESRWRGLYLLIERTDFRQNILMEILNVSK
EELMEDFEDCLDITQSGLYKHIYTSGYGQHGGQPVGTIVADYELSPSNYDIKFLNKVSSI
AAMSHAPFIAAAGPKFFGLDSFEGLPDLKDLEDIINSPQFTAWRGFRQNEDSKYVGLTLP
RFLLRAPYDPEDNPILNFSYKEDVSASHENYLWGNTVYAFASRLTESFASYRWCTNIIGP
TSGGEVKNLPVHTFESMGDIEMKIPTEVLISDRREYELSEQGFIPLVMRKGNNSATFFAA
SSVQIPKIFPDTEEGQIAQLNYKLGTQLPYLFAITRMSHYIKVLQREYIGSFRERADLER
ELNKWAKQYIANQENPSSEIRSKRPFKNMLIEVSDIVGDPGWYKVRIALRPHFKYMGANF
ELSLVGKLEKE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaaaagaacaaattgaaaatagccaaataagagaaaataatagtttattagat
gatatcgtttctcatacaaaacttaataaaaatgatgatagctataatgttgttaaaaat
ggtgttgaagcattaattcaagaattaattaatacagatgactcagaagaaagagtgaat
aaatcagtaattgataaaatgatagctgaattagatagaaaaatttctactcaaatggat
gagattatacataataaaaattttcaagaattagaatcaagatggagaggattatatctt
ttaatagagagaacagatttccgacagaatattctaatggaaattttgaatgtatctaaa
gaagagttaatggaagattttgaagattgtttagatattactcaatctggactatataaa
catatttatacaagtggttatggtcaacatggaggacaacctgttggaacaattgtagca
gattatgaattatctccatctaattatgatataaaatttttgaataaagtatcttcaatt
gcagcaatgtctcacgcaccattcattgcagctgctggtcctaaattttttggattggac
agttttgagggattacctgatttaaaagatcttgaagatattataaattcacctcaattt
actgcttggaggggatttagacaaaatgaagattcaaaatatgtaggtttaactttaccg
agattcttactaagagctccatatgatccagaagataatccaattttaaatttttcatat
aaagaagatgtttctgcaagtcatgaaaattatttatggggaaatactgtttatgctttt
gctagtagattaacagaaagttttgctagttatagatggtgtacaaatattattggtcca
acttctggaggtgaagtaaaaaatttacctgttcatacttttgaaagtatgggggatatt
gaaatgaaaattccaacagaagtgttaatatctgatagacgtgaatatgaattatcagaa
caaggatttattccattagtaatgagaaaaggtaataattcagctactttttttgctgca
agctctgttcaaattccaaaaattttccctgatacagaagaaggtcaaatagcacaatta
aattataaactaggtacgcagttaccttatttatttgcaattacaagaatgtctcattat
attaaagttttacaaagagaatatattggttcatttagagaaagagctgatttagaaaga
gaattaaataaatgggcaaaacaatatattgcaaatcaagaaaatccaagttctgaaatt
agaagtaaaagaccatttaaaaatatgttaatagaagtaagtgatattgtaggtgatcca
ggttggtataaagttagaattgcattacgtcctcattttaagtatatgggagctaatttt
gaattatctttagtaggaaagctagagaaagaataa

DBGET integrated database retrieval system