KEGG   Arcobacter sp. L: ABLL_2190Help
Entry
ABLL_2190         CDS       T01834                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
arc  Arcobacter sp. L
Brite
KEGG Orthology (KO) [BR:arc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:arc02044]
    ABLL_2190
Secretion system [BR:arc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABLL_2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: BAK74065
UniProt: G2HY62
Position
complement(2245023..2245514)
Genome map
AA seq 163 aa AA seqDB search
MKQSESPKERINVTYKHSVGEALEDIEIPYKMTILGEFNPSEERKSIEEKKTININKNNF
NEVIKAQNLKLNFDVKNRLNNSNNDSIKIDLDIKHISDFSPEKIVEKVPELKKLMELRQS
LIALKGPLGNVPAFRKAIESLVQDTNKREQLLSELNLITKDNN
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatcagaatcaccaaaagaaagaataaatgttacttataagcattcagtagga
gaggctttagaagatattgaaataccatataaaatgacaattttaggagaatttaatcct
tcagaagaaagaaaatcaattgaagagaaaaaaacaattaatatcaataaaaataatttt
aatgaagtaataaaagctcaaaatttaaagttaaattttgatgtaaaaaatagattgaat
aattcaaataatgattcaataaaaattgatttagatataaaacatattagtgatttttct
cctgaaaaaattgtagaaaaagtacctgaactcaaaaaacttatggaacttagacaatca
ttgattgcattaaaaggtccattaggaaatgttcctgcatttagaaaagcaatagaaagt
ttggttcaagatacaaataaaagagaacaattattatctgaacttaatttaataactaaa
gataataattaa

DBGET integrated database retrieval system