KEGG   Arcobacter sp. L: ABLL_2443Help
Entry
ABLL_2443         CDS       T01834                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
arc  Arcobacter sp. L
Pathway
arc00362  Benzoate degradation
arc00620  Pyruvate metabolism
arc00621  Dioxin degradation
arc00622  Xylene degradation
arc00650  Butanoate metabolism
arc01100  Metabolic pathways
arc01120  Microbial metabolism in diverse environments
arc01220  Degradation of aromatic compounds
Module
arc_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABLL_2443
   00650 Butanoate metabolism
    ABLL_2443
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABLL_2443
   00622 Xylene degradation
    ABLL_2443
   00621 Dioxin degradation
    ABLL_2443
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ABLL_2443
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     ABLL_2443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAK74318
UniProt: G2HYW5
Position
complement(2528475..2529359)
Genome map
AA seq 294 aa AA seqDB search
MEKINCALIGSGNIGTDLMYKLQRSKILNPLWMVGIDPDSDGLKKAKEAGMKITHEGVDG
LLPFIKEDGVKIAFDATSAYVHGENNRKLAELGVKVIDLTPAAIGPFCVPSVNIDELLAQ
NTQNVNMVTCGGQATIPMVAAVSSVQAVDYAEIIATVASKSAGPGTRANIDEFTETTKLG
IEKVGNVKKGKAIIILNPAEPPLMMRDTVHCQTVAQPNKEAITKSVHEMVKKVQQFVPGY
KLKNGPIFDGKKVSIYLEVEGLGDYLPKYAGNLDIITAAATNIAEKMAEKIKGE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaattaattgtgctttaattgggtctggtaatattggaacagatttaatgtat
aaacttcaaagaagtaagattttaaatcctttatggatggttggaattgaccctgattca
gatggattaaaaaaagcaaaagaagctggaatgaaaataacacatgaaggtgttgatgga
ttacttccatttatcaaagaagatggggtaaaaattgcttttgatgcaacatcagcttat
gttcatggtgaaaataatagaaaattagctgaacttggagttaaagttatagatttaaca
ccagcagctattggaccattttgtgtaccttctgtgaatattgatgaattattagcacaa
aatacacaaaacgtaaacatggtaacttgtggtggacaagcaactattcctatggttgct
gctgtatcttctgttcaagcagttgattatgcagagattattgcaacagttgcatctaaa
tcagcaggtcctggaactcgtgcaaatattgatgagtttacagaaactacaaaattagga
attgaaaaagttggaaatgtaaaaaaaggtaaagctattattattttaaatccagcagag
ccaccacttatgatgagagatactgttcattgtcaaacagttgcccaaccaaataaagaa
gcaattactaaatcagttcatgaaatggtaaaaaaagtacaacaatttgtacctggatat
aaactaaaaaatggaccaatttttgatggtaaaaaagtttctatttatttagaagttgaa
ggattaggagattatttaccaaaatatgcaggtaacttagacattatcacagcagctgca
acaaatattgcagaaaaaatggctgaaaaaatcaaaggagaataa

DBGET integrated database retrieval system