KEGG   Arcobacter sp. L: ABLL_2525Help
Entry
ABLL_2525         CDS       T01834                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
arc  Arcobacter sp. L
Pathway
arc00260  Glycine, serine and threonine metabolism
arc00750  Vitamin B6 metabolism
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01120  Microbial metabolism in diverse environments
arc01230  Biosynthesis of amino acids
Module
arc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABLL_2525
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ABLL_2525
Enzymes [BR:arc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ABLL_2525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP 6PGD
Motif
Other DBs
NCBI-ProteinID: BAK74400
UniProt: G2HZF1
Position
2620499..2621980
Genome map
AA seq 493 aa AA seqDB search
MNFIETRGNDGIKPIKVPFSEAILNPSTSFGGLYIPEYLPKLEENFIQNHVNKSYKELAY
DILKAFEIDIDENEINKALDLYDNFDNPQNPCPVIKVKKDLFVHEQYHGPTRAFKDMALQ
PFGSILSSIAKKRNEKYLILAATSGDTGPAALNTFKNKENIQVVCLYPDGGTSDVQRLQM
VCEDGKNLKVLGIKGNFDDAQSALKNLLASKTFKEELEKDNIKLSAANSVNFGRIIFQII
YHFWSYIQLLKQDEITLGEKIYLVVPSGNFGNVLGAFYALEMGLPIEKLLVASNENNILT
EWINTGVYDIRDKELKLTKSPAMDILKSSNIERVIYSLFGANRTKELMEDLNEKKIFKMS
ENETNEVKKYFSAVYSDDTFGTRTIKEFLDSGYLMDPHTATCIKAYNELREKPLKTVIYS
TAEWTKFSPTVLNALNQNSLKYADKEALEEISTKYNANLPQSIKDLFNAKINHSLVINKE
NIESEIVNFIRKS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaattttatagaaacaagaggaaatgatggtattaaaccaattaaagtaccatttagt
gaagcaatattaaatccaagtacatcttttggtggattatacatacctgaatatttacct
aaattagaagaaaattttattcaaaatcacgtaaataaaagctacaaagagttagcttat
gatattttaaaagcttttgaaattgatattgatgagaatgaaatcaataaagctttagat
ttatatgataattttgacaatccacaaaatccttgtcctgttataaaagtaaaaaaagat
ttgtttgttcatgagcaataccatggaccaactcgagcttttaaagatatggctttacaa
ccttttggttcaattctttcttcaattgcaaaaaaaagaaatgaaaaatatctaattctt
gctgcaacttcaggagacacagggccagctgctcttaatacttttaaaaataaggaaaac
attcaagttgtctgtttatatccagatggtggaacttctgatgttcaaagattacaaatg
gtttgtgaagatggaaaaaatttaaaagttttaggaataaaaggaaactttgatgatgcc
caaagtgcacttaaaaatctacttgcttcaaaaacttttaaagaagaattagaaaaagac
aatatcaaactaagtgctgcaaattcagtaaactttggaagaataatattccaaataatc
tatcatttctggtcatatattcaacttttaaaacaagatgaaattacattaggtgaaaaa
atatatttagtagttccaagtggaaacttcggaaatgttttaggagcattttatgcttta
gaaatgggattacctatcgaaaaacttttagtagcttcaaatgaaaacaatatacttaca
gaatggataaatactggtgtttatgatattagagataaagaacttaaactgacaaaatct
cctgcaatggatattttaaaatcttcaaatattgaaagagtaatttattctttatttggt
gcaaatagaactaaagagttaatggaagatttaaatgagaaaaaaatcttcaaaatgagt
gaaaatgaaacaaatgaagtaaaaaaatacttctcagctgtttattctgatgatactttt
ggtacaagaacaataaaagagtttttagactctggatatctaatggatcctcacactgcg
acttgtataaaagcatataatgagttaagagaaaaacctttaaaaacagttatttattca
actgcagaatggacaaaattctcaccaactgtattaaatgcattaaatcagaattctctt
aaatatgctgataaagaagctttagaagaaatttctacaaaatataatgcaaatttacct
caaagtattaaagacttatttaatgcaaaaatcaatcactctttagttattaataaagaa
aatattgaatctgaaatagttaattttattagaaaatcataa

DBGET integrated database retrieval system