KEGG   Arcobacter sp. L: ABLL_2579Help
Entry
ABLL_2579         CDS       T01834                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
arc  Arcobacter sp. L
Pathway
arc00900  Terpenoid backbone biosynthesis
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABLL_2579
Enzymes [BR:arc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ABLL_2579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N Toprim_Crpt
Motif
Other DBs
NCBI-ProteinID: BAK74454
UniProt: G2HZK5
Position
complement(2671784..2672560)
Genome map
AA seq 258 aa AA seqDB search
MKNEMIEKSYAKVNIFLKIADKRENYHELVSRFVRVHNLYDIISFVKSSRKAITIIGNFG
CKMDSNTVYKAYNLIKHFKGVEEFFLNHEIRIEKNIPEFAGLGGGSSNAATFLIMANKYC
KLNLSKDELSKIGAQVGADVPFFVYEYDSANVTGIGEIVEKFDEEILDIKTLTPKIKCNT
GEIFKIFREKFYKQISKEEAKKLLDMKSIDILKELDIKEANDLYESALSLYPQLSEFEKK
DWYFSGSGSSFFRINNGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaaatgattgaaaagtcgtatgctaaagtaaatatttttctaaaaattgca
gataaaagagaaaattatcacgaactcgtatcaagatttgtacgagttcataatttgtat
gacattatatcatttgttaaatctagtaggaaagcaattacaattataggaaattttggt
tgtaaaatggattcaaatactgtatataaagcatacaatttgataaaacattttaaaggt
gttgaagaattctttttaaatcatgaaattagaatagaaaaaaacattccagagtttgca
ggacttggtggcggaagttcaaatgcagctacatttttaattatggcaaataaatattgt
aaattaaatttatcaaaagatgaattaagtaaaataggtgcacaagttggtgctgatgtt
ccattttttgtttatgaatatgatagtgcaaatgtaacaggaattggagaaatagtagaa
aaatttgatgaagagattttagatataaaaactttaacaccaaaaataaaatgtaataca
ggtgaaatttttaaaatatttagagaaaaattttataaacaaatatcaaaagaagaagca
aaaaaattgcttgatatgaaatcaattgatattttaaaagagttagatataaaagaagca
aatgatttatatgaaagtgcactaagtctttatccacaacttagtgaatttgaaaaaaaa
gattggtattttagtggaagtggaagttcattttttaggataaataatggcaaataa

DBGET integrated database retrieval system