KEGG   Arthrobacter sp. ERGS1 01: AL755_15635Help
Entry
AL755_15635       CDS       T04085                                 

Definition
(GenBank) N-acetylglucosamine 6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
are  Arthrobacter sp. ERGS1:01
Pathway
are00520  Amino sugar and nucleotide sugar metabolism
are01100  Metabolic pathways
are01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:are00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AL755_15635
Enzymes [BR:are01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AL755_15635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALE06554
UniProt: A0A0M4MBY3
Position
2589637..2590887
Genome map
AA seq 416 aa AA seqDB search
MTVASGTPAPRLEKKLIHGSIITDHGVVEGGLLAIAGDRIVYAGRADHFDEPDFAAEDVD
AANVISIPAGHYVLPGLVDLHNHGGNGGDFPSGNEESARTAVEFLHKAGTTTLLASMVTA
SPADLIKGIGIYARMTDEGLLAGIHLEGPFLSHARCGAQNPAFLLNPDLDLTAELIEAGQ
GSIITMTYAPELPGAEDLVDLLTAHGITPSVGHTDSDTATAAASLEQARDGLDSTGFDGV
SGRPTVTHLFNGMPPMHHRAPGPVAACLRAAAAGQAAVELVADNTHLDPETVKTVFALVG
AENILLVTDSMAAAGLADGQYMLGPSPVTVTNGVATLDATGSIAGGTATLLDVVRRTVQA
GVSLTDALRSATVVPAAVLGLTDEVGSLRRGLRADAVIVDAELELQKVLRAGEWLR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgccagcggcacccccgccccacgccttgaaaagaaactgatccacggatcc
atcatcaccgaccacggcgtcgtggagggcggcctgctcgccattgccggcgacaggatc
gtgtacgccggccgtgccgaccactttgacgagcccgacttcgcggccgaggacgtggac
gccgccaacgtcatctccatcccggccgggcactatgtgctcccgggcctggtggacctg
cacaaccacggtggcaacggcggagacttccccagcggcaacgaggaatccgcccgcacg
gccgtggagttcctgcacaaggccggcaccaccacgctgctggccagcatggtcacggcc
tcccccgccgacctcatcaagggcatcggcatctacgcaagaatgaccgacgagggcctg
ttggccggcatccacctggagggcccgttcctctcgcacgcccgctgcggcgcacagaac
ccggccttcctgctcaaccccgaccttgacctcacggcggaactgatcgaggccggccag
ggcagcatcatcaccatgacctacgcccccgagctccccggcgccgaggacctcgtggac
ctgctgacagcacacggcatcaccccgtccgtgggccacaccgactcggacacggccacg
gccgccgcctccctcgagcaggcccgcgacggtttggactcgaccgggttcgacggcgtc
tccggccgccccaccgtcacccaccttttcaacggcatgccgcccatgcaccaccgggcc
ccgggccccgtggccgcgtgcctgcgggccgcggcagccgggcaggccgccgtggaactc
gtggccgacaacacccacctggacccggaaaccgtcaagaccgtctttgcgctggtgggg
gcggagaacatcctgctggtcaccgactccatggcggcggcggggctcgcggacggccag
tacatgctcgggccctcccccgtcaccgtcaccaacggcgtggccaccctggacgccacc
ggttccattgccggcgggacggccaccctgctggacgtggtgcgccgcaccgtgcaggcc
ggagtgtcgctcaccgacgccctgcgctccgccaccgtggtgccggccgccgtgctggga
ctgaccgacgaggttggctcgctgcgccgcgggctgcgcgccgacgccgtgattgtcgac
gccgagttggagctgcagaaggtgctgcgcgccggcgaatggctgcgctag

DBGET integrated database retrieval system