KEGG   Anaerostipes rhamnosivorans: AR1Y2_0097Help
Entry
AR1Y2_0097        CDS       T05962                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
arf  Anaerostipes rhamnosivorans
Pathway
arf00450  Selenocompound metabolism
arf00970  Aminoacyl-tRNA biosynthesis
arf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AR1Y2_0097
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AR1Y2_0097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arf01007]
    AR1Y2_0097
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:arf03016]
    AR1Y2_0097
Enzymes [BR:arf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AR1Y2_0097
Amino acid related enzymes [BR:arf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AR1Y2_0097
Transfer RNA biogenesis [BR:arf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AR1Y2_0097
 Prokaryotic type
   Other AARSs
    AR1Y2_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1f Anticodon_1 tRNA-synt_1e TackOD1 DnaG_DnaB_bind
Motif
Other DBs
NCBI-ProteinID: QCP33551
UniProt: A0A4P8IAJ3
Position
119461..121407
Genome map
AA seq 648 aa AA seqDB search
MSKEPYYITTAITYTSGKPHIGNTYEIILADSIARYKRMEGHDVFFQTGTDEHGQKVELK
AAEQGVTPKEFVDDVAGEIKRIWDLMNTSYDKFIRTTDADHEAQVQKIFKKLYEQGDIYK
DHYEGLYCTPCESFFTESQLVDGKCPDCGREVQPAKEEAYFLKLSKYADRLIEHINTHPE
FIQPESRKNEMMNNFLLPGLQDLCVSRTSFKWGIPVDFDEGHVVYVWLDALTNYITGIGY
DCDGNSTEQFNKFWPADLHLIGKDIIRFHTIYWPIILMALDLPLPKQVFGHPWLLQGDGK
MSKSKGNVLYADDLADMFSVDAVRYFVLHEMPFEHDGVISWELMVERMNSDLANTLGNLV
NRTISMSNKYFDGVVEDKGVVDEFDDQLKAVVTGARDKVQKKMDVLKVADAMTEIFNVFK
RCNKYIDETMPWVLAKDEEKKDRLATVLYNLVEGILTGAALLEPYMPETAGKILKQLNAE
PRSFEDLTTFGHYKSGTKVTEKPEILFARLDEEEVLKQAEELMNKQAQAAAGPVIDIEPK
EEITFDEFGKMQFQVGEIIACEEVKKSKKLLCSQVRVGSEVKQIVSGIKAYYKPEEMVGK
KVMVLVNLKPAKLAGVLSEGMLLCAENEKGELALVVPEKDMPAGAEIC
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaccatattatataacaactgcgattacttatacatctggcaagcctcac
atcgggaatacttatgagatcatcttggcagatagtattgccagatataaaagaatggaa
ggtcatgacgtattttttcagaccggtaccgatgagcatggacagaaggtggaattaaaa
gcagccgagcagggtgtgacaccgaaagagtttgtggatgacgtggcaggagagatcaaa
cggatctgggatttgatgaatacttcttatgataagtttatccgtacaacagatgcagac
catgaagcccaggtacagaagatttttaaaaagctgtatgagcagggtgatatttataag
gatcactatgagggactttactgtaccccgtgtgagtcatttttcacagaaagccagctc
gtggacggcaaatgtcctgactgcggacgggaagtccagccggccaaggaagaggcgtat
ttcttaaaactcagcaaatatgcggacaggctcattgagcacatcaatacccatccggaa
tttattcagccggagtccagaaaaaatgagatgatgaacaacttcctgctcccgggactt
caggacttgtgtgtgtccaggacctcctttaagtggggaatcccggtagattttgatgag
gggcatgtggtctatgtatggctagacgcactgaccaactacatcactggtatcggatat
gactgtgacggaaacagcacagaacagttcaacaagttctggccggcggacctgcatctg
atcggaaaagacatcatccgtttccatacaatctactggccgatcatcctgatggcactt
gaccttccgcttccaaagcaggtatttggacatccgtggctgttacagggtgacggtaag
atgagcaagtcaaaaggaaatgttctgtacgcagatgatctggctgatatgttcagcgtg
gatgcggtgcgctattttgtcctccatgaaatgccgtttgaacatgacggtgtgatctca
tgggagctgatggttgagcgtatgaactctgatcttgctaacaccttaggcaatcttgtg
aaccgcaccatttccatgtccaacaaatactttgatggagtcgtggaagataagggtgtt
gtggatgagtttgacgaccagctgaaagctgtggtaaccggtgccagagataaggtccag
aaaaagatggacgtgctcaaggtggcagatgccatgacagagatctttaatgtattcaag
cgctgcaacaagtatattgatgaaaccatgccgtgggtgctggcaaaggatgaagaaaag
aaagaccgtctcgcaacggtattatataatttggtggaaggtattttaaccggggcagca
ttgctggagccatatatgccagagactgcaggaaagatcttaaaacagctgaatgcggaa
cctagaagctttgaggatctgaccacatttggccattataagagcggtacgaaagtgaca
gaaaagcctgagatcctttttgcgcggcttgatgaagaagaggtgctcaaacaggcggaa
gagctgatgaacaagcaggcacaggcggcagcaggtcctgtgatcgatattgagccaaaa
gaagaaatcacctttgacgagttcggaaagatgcagttccaggtaggtgagatcattgcc
tgcgaggaagtcaaaaagtccaagaagctgctctgctcccaggtgcgcgtgggaagtgaa
gtgaagcagatcgtttctggtatcaaggcctattataagccggaagagatggtcggcaaa
aaagtcatggtcttagtaaacttaaagcctgctaagcttgcaggtgttttatctgaggga
atgcttttgtgtgctgagaatgaaaagggagaactggccctggtagtgccggaaaaagac
atgccagcaggggcagagatctgctag

DBGET integrated database retrieval system