KEGG   Anaerostipes rhamnosivorans: AR1Y2_0177Help
Entry
AR1Y2_0177        CDS       T05962                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
arf  Anaerostipes rhamnosivorans
Pathway
arf00561  Glycerolipid metabolism
arf00640  Propanoate metabolism
arf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AR1Y2_0177
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AR1Y2_0177
Enzymes [BR:arf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AR1Y2_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: QCP33631
Position
193774..194856
Genome map
AA seq 360 aa AA seqDB search
MASIIASPSRYIQGKGEIKNLCTYAENYGSNLFVLTSPSGRKRVEPSITEGQKDAKITYE
AFNGECCMTEINRVMDMCKKAGSEVIVGIGGGKIHDTAKAVGYYMKKPVIIVPTIASTDA
PCSALSVIYSDEGVFEKYLFLPASPNMVLVDTDIVSKAPERLLVAGMGDALATYFEARAC
KQSDASNCVGGKITRAAMALAELCYETLIDEGIDAKLAVRENICTKAVEHIIEANTYLSG
IGFESGGLAGAHAIHNGLTAIPETHELYHGEKVAFGTLVQLVLEGADQDEIQEVLGFCQE
AELPTTLADLGIKEVKEDQIMEVARLACSPDDTLGNMPFEVTPEDVYAAIIAADALGRYY
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtattatcgcaagcccaagccgttatatccagggaaaaggggagatcaagaac
ctgtgtacatatgcggaaaactacggaagcaacctttttgtactgacaagcccatccgga
agaaaaagggtggaaccttccatcacagaaggacagaaagatgccaagatcacttatgaa
gcatttaacggagagtgctgcatgacagagatcaaccgtgtcatggatatgtgcaagaag
gcaggaagcgaagtcatcgtgggaatcggcggcggaaagatccacgatactgcaaaggca
gtgggttattacatgaagaagccagtgatcatcgtgccgaccattgcatctaccgacgct
ccgtgcagcgcactgtctgtgatctattctgacgaaggtgtatttgagaaatatctgttc
cttcctgcaagtccgaatatggtgctggtagacaccgacatcgtcagcaaagcaccggaa
cgcctgttggtagcaggaatgggagacgctttggcaacgtattttgaggcgagagcatgt
aaacagtccgacgcatccaactgtgtaggaggaaagatcacacgtgcggcaatggctctg
gcagagctttgttatgaaaccctgatcgatgaggggattgacgcgaaacttgctgtccgt
gagaatatctgtacaaaagcagtggaacatatcattgaggcaaacacctatctttccggt
attggatttgagagcgggggcctggcaggggcacatgccatccacaacggtctgaccgcg
atcccggaaacccatgagttataccatggagaaaaggtagccttcggaactctggtacag
ttggtcctggaaggggcagatcaggatgagattcaggaagtccttggtttctgtcaggag
gcagaacttccgacgacccttgcagatctgggaatcaaagaagtaaaagaagatcagatc
atggaagtggcacgccttgcatgttctccggatgacactctcggcaacatgccgtttgag
gtgacaccggaggatgtatatgcagccatcattgcagcagacgcactgggaagatattat
taa

DBGET integrated database retrieval system