KEGG   Anaerostipes rhamnosivorans: AR1Y2_0892Help
Entry
AR1Y2_0892        CDS       T05962                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
arf  Anaerostipes rhamnosivorans
Pathway
arf00051  Fructose and mannose metabolism
arf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AR1Y2_0892
Enzymes [BR:arf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AR1Y2_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C TrkA_N ApbA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: QCP34346
Position
913842..914972
Genome map
AA seq 376 aa AA seqDB search
MKNVLIVGAGRLGKGFVGETFDNAGWNITFLDKDPRVSEELLKHGCYYVKVHRVDEIQNR
TVKNFQAFTCDEAYSCMEAFLETDVIVLPLYPEDFEEAAEYLAKCFEEFFKVHPERKLTM
ICITNKNYLIPGITEAFKKDLSQDARNWFDQNVVIRDSIIRRSTDASSNYDVHIDTVAVN
SLLIQQPVNNDISDVEWMELTDKIEMLKDIKVIAVNGPHATLAYMGYLKGYHTIPESEAD
PEIAQVVKEVVEELTEAVMKEYPITPEELHNLVYFAPAQGVLPDSIYRVGYDPIRKLSKG
DRLTGAAQLCLKHGVCFDAIAKGMAAGFKYAEPRDANAQKLQKEIKELGIGQAVCKYTGL
EPDSPIVQRVIEEYNR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtattgattgtgggagccggacgtttgggaaagggctttgtaggagagaca
ttcgacaatgcagggtggaatattacctttctggataaggatccgagggtctcagaggaa
cttttgaagcacggatgctactacgtgaaggtgcaccgtgtggatgagattcaaaaccgt
acggtcaaaaattttcaagcgtttacatgtgatgaagcatattcttgtatggaagctttt
ttggagaccgatgtgatcgttctgccattatatccggaagattttgaggaagcggccgag
tatttggcaaagtgctttgaagagttttttaaggtgcatccggagcgcaaattgacaatg
atctgcattacaaacaaaaactatctgatcccgggaatcacggaggccttcaagaaagac
ttatcccaggatgcaagaaactggtttgaccaaaatgttgtgatccgtgattctattata
cgaagaagcacggatgcaagcagtaattatgatgtacatatcgacacggtggcggtgaat
tctcttctgatccagcagccggtaaacaatgatatcagtgacgtggagtggatggagctt
acagacaagatcgagatgttaaaagacatcaaagttattgcggtcaatgggcctcatgct
acactggcatatatggggtatcttaagggatatcatacgattcctgagtcagaggccgac
cctgagattgcgcaggttgtcaaagaagttgttgaggaactgacggaagccgtcatgaag
gaatacccgattacaccggaagaactgcacaatcttgtgtattttgctccggctcagggc
gtgcttccagattctatttaccgtgttggatatgacccgatccggaagctatcaaaagga
gaccggctcacaggtgcagcccagctgtgtctgaaacacggagtctgctttgacgccatt
gcaaaagggatggcggccggttttaagtatgcggagccgagggatgccaacgcacagaag
ctccaaaaggagatcaaggagctgggaatcgggcaggcggtgtgcaaatataccggtctg
gagccagacagccctattgtacagcgtgtgatcgaagagtataaccgttaa

DBGET integrated database retrieval system